KEGG   Archangium gephyra: AA314_07912Help
Entry
AA314_07912       CDS       T03948                                 

Definition
(GenBank) Mannose-1-phosphate guanylyltransferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
age  Archangium gephyra
Pathway
age00051  Fructose and mannose metabolism
age00520  Amino sugar and nucleotide sugar metabolism
age01100  Metabolic pathways
age01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:age00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AA314_07912
   00520 Amino sugar and nucleotide sugar metabolism
    AA314_07912
Enzymes [BR:age01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AA314_07912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep
Motif
Other DBs
NCBI-ProteinID: AKJ06286
UniProt: A0A0G2ZXD4
Position
complement(9914273..9915301)
Genome map
AA seq 342 aa AA seqDB search
MKAMVLCAGLGTRLRPFTERWPKPAMPFLGQPLFRYHLAVLRAAGVQGVGINTHHLPDVM
AATARAECARVGLPLHVVHEPVIQGTGGGIRGLRDFLAGDDFIVFNGDILFPVDLRPVVA
AHRASGAAATMVLLPMPENEKYAAVEMDAQQRVRRIARFGPGGEGLTPWHFTGVHVMSSR
VFDFMTPEGPEDINRDVYVRMMEAGLTVRGEVVRSYWSDLGTPSRYLSTVRDVLSGQVPL
EGLGTDSPFVSAPRAQGNYWAHPSARVGGAQVTGPAHLDAGCSLAEGVRVGASVSVGAQA
RVGAGARLERCAILEGTEIAPGEELAEVMAWGAHRVPAPLTP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaatggtcctctgcgcggggctgggtacgcgcctgcgtccgttcaccgagcgt
tggcccaagccggcgatgccgttcctcgggcagcccctcttccgctaccacctggcggtg
ctgcgggccgccggagtgcagggagtgggcatcaacacccaccacctgccggacgtcatg
gcggccaccgcccgcgccgagtgcgctcgcgtgggcctgccgctgcacgtggtgcacgag
cccgtcatccagggcaccggcggcggcatccggggcctgcgggacttcctcgcgggggat
gacttcatcgtgttcaacggggacatcctgttcccggtggacctgcggcccgtggtggcg
gcgcaccgggcctcgggcgcggcggccaccatggtgctgctgcccatgccggagaacgag
aagtacgccgcggtggagatggacgcgcagcagcgcgtgcgccgcatcgcgaggttcggg
cccgggggcgagggactcacgccctggcacttcacgggcgtgcacgtcatgtcctcgcgc
gtcttcgacttcatgacgcccgagggccccgaggacatcaaccgcgacgtgtacgtgcgg
atgatggaggcgggcctcaccgtgcgcggcgaggtggtgcgctcgtactggtccgacctg
ggcacgccctcgcgctacctgtccaccgtgcgcgatgtgctctccgggcaggtgccgctg
gaggggctgggcacggactcacccttcgtctcggcgccgcgtgcgcaggggaattactgg
gcgcatccgtccgctcgcgtgggtggggcccaggtgacgggtccggcgcacctggacgcg
gggtgctcgctggcggagggggtgcgcgtgggggcctcggtgtccgtgggcgcgcaggcc
cgcgtgggcgcgggagcccggctcgagcgctgcgccatcctggaggggaccgagattgct
cccggcgaggagctggccgaggtgatggcctggggggcacaccgggtgcccgcgccgctc
accccgtag

DBGET integrated database retrieval system