KEGG   Agromyces sp. FW100M-8: ET445_01145Help
Entry
ET445_01145       CDS       T05835                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
agf  Agromyces sp. FW100M-8
Pathway
agf00620  Pyruvate metabolism
agf00630  Glyoxylate and dicarboxylate metabolism
agf01100  Metabolic pathways
agf01110  Biosynthesis of secondary metabolites
agf01120  Microbial metabolism in diverse environments
agf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:agf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ET445_01145 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    ET445_01145 (aceB)
Enzymes [BR:agf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ET445_01145 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: QAY72145
UniProt: A0A4P6F985
Position
complement(250279..251991)
Genome map
AA seq 570 aa AA seqDB search
MNTLIIDTPPTARRDESQAPSRRTPAEPKPATGSFQAVEPRIEITAPQGERYDEILTPEA
LAFLAELHDRFAGTRHDLLAARLKTRVHAANGRDPKFLPETAHIREDASWRVAGAGPGLE
DRRVEITGPTDRKMAINALNSSAKVWLADQEDATSPTWRNVIEGQLSLFDALRGTLEYTS
PEGKEYRLDRDIRETPTIVFRPRGWHLTEKHLRFHDRAGRALHASGSLVDFGLYLFHNAA
KLIELGRGPYFYLPKLESHLEARLWNDIFVFAQERLGLPQGTVRATVLIETIQAAFEMDE
ILYELRDHCAGLNAGRWDYIFSIVKTFRSRGRRWVLPDRKQISMTVPFMRSYTELLVQTC
HKRGAHAIGGMSAFIPNRRNPEVTERAFAQVASDKRREAGDGFDGTWVAHPDLIPTARAE
FDAVLGERPNQVERLRDDVEVTAAQLLDIESAGGQVTEAGVRDNISIAIRYVESWLRGVG
AAAIDDLMEDAATAEISRSQIWQWLNENTVTAEGTRIDQTSIVRLMAEAVAGLPRFEGDR
FDDAISVFRSVALEPEFPTFLTVAAYARFL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccctcatcatcgacacgcccccgaccgcgcgccgcgacgagtcgcaggcgccc
tcgcgccgcacgcccgcagagcccaagcccgcgaccggcagcttccaggccgtcgagccg
cgcatcgagatcaccgcgccgcagggcgagcgctacgacgagatcctcacgcccgaggcc
ctcgcgttcctcgccgaactccacgaccgcttcgccggcacccgccacgacctgctcgcg
gcgcgcctgaagacgcgcgtccacgccgcgaacggccgtgatccgaagttcctgcccgag
acggcgcacatccgcgaggatgcctcgtggcgcgtcgcgggcgccggccccggcctcgaa
gaccgccgcgtcgagatcacgggcccgaccgaccgcaaaatggcgatcaacgcgctcaac
tcgagtgcgaaggtctggctcgccgaccaggaggatgccacgagccccacctggcgcaac
gtcatcgagggacagctgagcctgttcgatgcgctgcgcggcaccctcgagtacacgagt
cccgagggcaaggagtaccgactcgaccgcgacatccgagagactccgacgatcgtgttc
cgcccgcgcgggtggcacctgaccgagaagcacctgcggttccacgaccgtgcgggccgg
gcactgcacgcgtcgggctcgctcgtcgacttcggcctgtacctcttccacaacgcggcg
aagctcatcgaactcggccgcggcccgtacttctacctgccgaagctcgagtcgcacctc
gaggcgcgcctctggaacgacatcttcgtcttcgcgcaggagcgcctcggcctcccgcag
ggcacggtccgcgcgaccgtcctcatcgagacgatccaggccgcgttcgagatggacgag
atcctctacgagctccgcgatcactgcgccggcctcaacgccgggcgctgggactacatc
ttctcgatcgtgaagacgttccgctcgcgcggccgccggtgggtgctgcccgaccgcaag
cagatctcgatgaccgtgccgttcatgcgctcatacaccgagctcctcgtgcagacgtgc
cacaagcgcggagcacatgccatcggcggcatgagcgcgttcatcccgaaccgccgcaac
cccgaggtcaccgagcgcgcgttcgcgcaggtcgcctccgacaagcgccgcgaggcgggc
gacgggttcgacggcacgtgggtcgcgcaccccgacctcatcccgacggctcgcgccgag
ttcgacgccgtgctcggcgagcggccgaatcaggtcgagcgccttcgcgacgacgtcgag
gtgactgccgcacagctgctcgacatcgagtcggcgggcggccaggtgaccgaggcgggc
gtgcgcgacaacatctcgatcgcgatccgctacgtcgagtcctggctccgcggcgtcggc
gccgcggccatcgacgacctcatggaggacgccgcgacggcagagatctcgcgttcgcag
atctggcagtggctcaacgagaacaccgtcaccgccgagggcacgcgcatcgaccagacg
tcgatcgtgcggctcatggccgaggccgtcgcgggccttccgcggttcgagggcgaccgg
ttcgacgacgcgatctcggtgttccggtcggtcgcgctcgagcccgagttcccgacgttc
ctgacggtcgcggcgtacgcacgcttcctctag

DBGET integrated database retrieval system