KEGG   Agromyces sp. FW100M-8: ET445_14715Help
Entry
ET445_14715       CDS       T05835                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
agf  Agromyces sp. FW100M-8
Brite
KEGG Orthology (KO) [BR:agf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ET445_14715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: QAY74391
UniProt: A0A4V0YHE1
Position
complement(3153739..3154917)
Genome map
AA seq 392 aa AA seqDB search
MDLTLIVVLVVALALFFDFTNGFHDTANAMATPIATGALRPKVAVGIAASLNLVGAFLST
EVAKTISGGIIREGDGGVLITPELIFAGLIGAIVWNMLTWLLGLPSSSSHALFGGLIGAA
LVGFGLQAIDFGVVLSKVILPALLAPLTAGLIAFAATRLAYAITRRYDGKPDGRDGFRFA
QIFSSSLVALAHGTNDAQKTMGVITLTLIAVGFQEVGTGPEFWVVVVCAIAIALGTYMGG
WRIIKTLGTGLTDVKPAQGFAAETSTAATILASSHLGFALSTTQVASGSVIGSGLGRRGS
KVRWRTAGRIGLGWLMTLPAAAAVGALAALVAHLGVIGIMIDAIAGIGVIVVIFAISRRS
EVSHNNVVSEVADSGRAVKIKRNPKPKKKVKA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcaccctcatcgtcgtgctggtcgtcgcactggcgctcttcttcgacttcacg
aacggcttccacgacaccgccaacgccatggcgacgccgatcgcgacgggcgcgctgcga
ccgaaggtcgccgtcggcatcgcggcgtcgctcaacctcgtcggcgcgttcctgtcgacc
gaggtcgcgaagacgatctcgggcggcatcatccgcgagggcgacggcggcgtgctcatc
acgcccgagctcatcttcgcgggcctcatcggcgcgatcgtctggaacatgctcacgtgg
ctcctcggcctgccgtcgtcgtcgagccatgcgctcttcggcggcctcatcggcgcggcg
ctcgtcgggttcggcctgcaggcgatcgacttcggcgtcgtgctgtcgaaggtcatcctc
ccggcactgctggcacccctcacggcggggctcatcgcgttcgccgcgacgaggctcgcc
tacgccatcacccgccgctacgacggcaagcccgacggccgcgacgggttccgcttcgcg
cagatcttctcgtcgtcactggtcgcgctcgcgcacggcacgaacgacgcgcagaagacg
atgggcgtcatcacgctcaccctgatcgccgtcggcttccaggaggtcggcacggggccc
gagttctgggttgtggtcgtgtgcgcgatcgcgatcgcgctcggcacctacatgggcggc
tggcgcatcatcaagacgctcggtacgggcctgaccgacgtgaagcccgcccagggtttc
gcggccgagacgtcgacggcggcgacgatcctcgcctcgagccacctcgggttcgccctc
tcgacgacgcaggtcgcctcgggatcggtcatcgggtcgggactcggccgtcgcgggtcg
aaggtgcgctggcgcaccgccggacgcatcggactcggatggctcatgacgcttcccgcc
gcggcggcggtcggcgccctcgcggccctcgtcgcgcacctcggcgtcatcggcatcatg
atcgacgcgatcgccggcatcggcgtcatcgtcgtgatcttcgcgatctcccgtcgcagc
gaggtctcccacaacaacgtcgtgagcgaggtcgccgactccggccgcgcggtgaagatc
aagcgcaaccccaagccgaagaagaaggtcaaggcgtga

DBGET integrated database retrieval system