KEGG   Agromyces sp. FW100M-8: ET445_16675Help
Entry
ET445_16675       CDS       T05835                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
agf  Agromyces sp. FW100M-8
Pathway
agf00020  Citrate cycle (TCA cycle)
agf00620  Pyruvate metabolism
agf01100  Metabolic pathways
agf01110  Biosynthesis of secondary metabolites
agf01120  Microbial metabolism in diverse environments
agf01130  Biosynthesis of antibiotics
agf01200  Carbon metabolism
Module
agf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:agf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ET445_16675
   00620 Pyruvate metabolism
    ET445_16675
Enzymes [BR:agf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     ET445_16675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: QAY74727
UniProt: A0A4P6FL25
Position
complement(3596979..3598457)
Genome map
AA seq 492 aa AA seqDB search
MHSEETVDVVLIGGGIMSATLGSLISRLQPDWSIRVYERLGEVAQESSNAWNNAGTGHAA
LCELNYMPEAKDGTVDASKAISINEQFQISRQYWAYLVEQGDLPEPTNFINTAPHMTFVR
GQKNIEYLRKRVAALKDQPLFPGMEYTEDLERIAQWTPLLAKRRNPKQKVAATRIESGTD
VDFGALTRSLFADLEKRGAQVNTDTQVTWLKRRKDGVWNLKLRRLVGNTPDSVRARFVFV
GAGGGALALLQHSGIPEIKGFGGFPISGQFLRTTNPKIVAQHQAKVYGKAAVGAPPMSVP
HLDTRVVDGETALLFGPYAGFTPKFLKSSTWFDLPFSIRLHNIGTMLGVAFKNFDLVKYL
VGELLAGREKKMRALREFMPTAKSEDWELITAGQRVQVMKHEDGKGGVLQFGTEVITGAD
GSIAGLLGASPGASTAAPIMLDVLKRCFPDRIDGWAPKIREMIPSYGTTLNGDPEVAAAS
LARTAKALQLQA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgcattctgaggaaaccgtcgacgtcgtgctcatcggcgggggcatcatgagcgccacg
ctcggctccctgatctcccggctccagcccgactggagcatccgggtctacgagcgactc
ggcgaagtggcgcaggaatcctccaacgcgtggaacaacgcgggcaccggccacgcggcc
ctgtgcgagctcaactacatgcccgaggccaaagacggcacggtcgatgcctcgaaggcg
atctcgatcaacgagcagttccagatcagccgccagtactgggcgtacctcgtggagcag
ggcgatctgcccgagccgacgaacttcatcaacacggccccgcacatgacgttcgtgcgc
ggtcagaagaacatcgagtacctgcgtaagcgcgtcgcggcgctgaaagaccagccgctc
ttccccggcatggagtacaccgaagacctcgagcgcatcgcgcagtggactccgctcctc
gcgaagaggcgcaaccccaagcagaaggtcgcggcgacccgcatcgagtcgggcaccgac
gtcgacttcggcgccctcacgcgctccctgttcgccgacctcgagaagcgcggcgcgcag
gtgaacaccgacacgcaggtcacgtggctgaagcgccgcaaagacggtgtctggaacctg
aagctccgccgactcgtgggcaacacccccgactcggtgcgcgcgcgcttcgtgttcgtc
ggcgcgggcggcggcgccctcgcgctgctgcagcactcgggcatccccgagatcaagggc
ttcggcgggttcccgatctcgggccagttcctccgcacgacgaaccccaagatcgtcgcc
cagcaccaggccaaggtctacggaaaggccgccgtcggcgcgccgccgatgtcggtgccg
cacctcgacacgcgcgtcgtcgacggcgagacagcgctgctcttcggcccgtacgcgggc
ttcacgcccaagttcctgaagtcgagcacgtggttcgacctgccgttctcgatccgtctg
cacaacatcggcacgatgctcggcgtcgcgttcaagaacttcgacctcgtgaagtacctc
gtgggtgaactcctcgcgggccgcgagaagaagatgcgggcgctgcgcgagttcatgccg
accgcgaagtccgaagactgggagctcatcaccgccggtcagcgcgtgcaggtcatgaag
cacgaagacggcaagggcggcgtgctgcagttcggcaccgaggtcatcacgggcgccgac
ggctcgatcgcgggtctcctcggcgcgtcgccgggtgcatcgacggccgcgcccatcatg
ctcgacgtgctcaagcgctgcttccccgaccgcatcgacggctgggcgccgaagatccgc
gagatgatcccgtcgtacgggacgacgctcaacggcgaccccgaggtcgccgccgcatcg
ctcgcgcgcacggcgaaggcgctgcagctccaggcgtag

DBGET integrated database retrieval system