KEGG   Agrococcus sp. SGAir0287: C1N71_01110Help
Entry
C1N71_01110       CDS       T05973                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
agg  Agrococcus sp. SGAir0287
Brite
KEGG Orthology (KO) [BR:agg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    C1N71_01110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FA_desaturase Phage_holin_3_6 Halogen_Hydrol YqzE
Motif
Other DBs
NCBI-ProteinID: QCR18216
UniProt: A0A4P8R4A5
Position
239204..240460
Genome map
AA seq 418 aa AA seqDB search
MQELAILVIVVLVALAFDFTNGFHDTANAMAPSVATGALKPKVAVALSASLNLVGAMLSI
EVARTVGSGIVDLTGVDGESLMLIVLCGLTGAIIWNVLTWLFGLPSSSSHSLFGGLIGAT
IAALGLTGVLWGGVAQKILIPALLAPVIAGLVAFTGTWLVHRVTRRISTRTEQRGFRWGQ
IGAASLMSLAHGTNDAQKTMGVIFLALVAHGSLDPDADMPLWIRVVCALAIAAGTYMGGW
RVIRTLGKGIVDISPRQGMSADFSSASIILTSSHLGLPLSTTHVASGSVIGSGMARTDAT
VRWSVARRMLLAWIVTLPAAGAVGAVCFLIAGLFGHLWGAVVITAVLIVACAAMWLRSRQ
SHVDHANVGDDWDALPKEERKQVKRERKKAIDRELSTVASGIAPVAKPRKRRRSKDGA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagctcgcgatcctcgtgatcgtcgtcctcgtggcgctggcgttcgacttcacg
aacggcttccatgacacggcgaacgccatggccccctcggtcgcgaccggcgccttgaag
cccaaggtcgcggtcgcgctgtcggcgtccctcaacctcgtcggcgccatgctgtcgatc
gaggtcgcacgcaccgtcggctccggcatcgtcgacctcacgggcgtcgacggcgagtcg
ctgatgctcatcgtgctgtgcgggctcacgggcgccatcatctggaacgtcctgacgtgg
ctgttcggcctcccgtcgtcgtcgagccactcgctcttcggcggcctcatcggcgcgacg
atcgccgcgctcggcctcacgggcgtgctgtggggcggcgtggcgcagaagatcctcatc
cccgcgctcctcgcgcccgtcatcgccggactcgtcgccttcaccggcacgtggctcgtg
caccgcgtcacgcgacgcatctcgacgcgcacggagcagcgcggcttccgatggggccag
atcggcgccgcgtcgctcatgtcgctcgcgcacggcacgaacgacgcgcagaagacgatg
ggcgtcatcttcctcgccctcgtcgcgcacgggtcgctcgaccccgacgccgacatgccg
ctgtggatccgggtcgtctgcgcgctcgcgatcgccgccggcacgtacatgggcggctgg
cgcgtcatccgcaccctcggcaagggcatcgtcgacatctcgccccggcagggcatgtcg
gcggacttctcgagcgcgtcgatcatcctcacctccagccacctcggcctgccgctgtcg
acgacgcacgtcgcatccggctccgtcatcggctcgggcatggcgcgcaccgacgcgacc
gtgcgctggtcggtcgcgcggcgcatgctgctcgcgtggatcgtgacgctgccagccgcc
ggcgcggtgggcgccgtgtgcttcctcatcgccggcctgttcgggcacctgtggggcgcc
gtcgtcatcacggccgtgctcatcgtcgcgtgcgcggcgatgtggctgcggtcgcggcag
agccacgtcgaccacgcgaacgtcggcgacgactgggatgcgctgcccaaggaggagcgc
aagcaggtcaagcgcgagcgcaagaaggcgatcgaccgcgagctgtcgacggtcgcgtcc
ggcatcgcacccgtcgcgaagccccgcaagcgccgccgctcgaaggacggtgcgtga

DBGET integrated database retrieval system