KEGG   Agrococcus sp. SGAir0287: C1N71_01465Help
Entry
C1N71_01465       CDS       T05973                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
agg  Agrococcus sp. SGAir0287
Pathway
agg00260  Glycine, serine and threonine metabolism
agg01100  Metabolic pathways
agg01110  Biosynthesis of secondary metabolites
agg01120  Microbial metabolism in diverse environments
agg01130  Biosynthesis of antibiotics
agg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:agg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C1N71_01465
Enzymes [BR:agg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C1N71_01465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: QCR18278
UniProt: A0A4P8R2F2
Position
complement(325816..326868)
Genome map
AA seq 350 aa AA seqDB search
MQQIHDPSIRTFASDNYAGVHPAVLAAIATANEGHVVSYGADPYTVRLQEVVRRHLGPQA
EAFPVFNGTGANVLALQSCLPRWGAVICSSGAHIQVDEGGAPERVGGLKLLTVPTPDGKL
TPELVDREAWGFGDEHRAQPGIVSITQSTEIGTLYTADEIRALADHAHERGMLLHVDGAR
IANAAAALDAPLHAFLTDAGVDILSLGGTKDGALAAEAVVTLSERAGAGLTYLRKLDMQL
ASKMRFLSAQLLALYDGDVWLENARHANAMAARLRAALEGVDGVDFVQPTQANGVFAHLP
AGVADRVRESFMFYDWNGTSGEVRWMCSWDTTEADVDAFAAAVRAAVASA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagatccacgaccccagcatccgcaccttcgcgagcgacaactacgcgggcgtg
cacccggcggtgctcgccgcgatcgcgaccgcgaacgaggggcacgtcgtctcgtacggc
gcggacccgtacaccgtgcggctgcaggaggtcgtgcgtcggcacctcggaccgcaggcg
gaggccttccccgtcttcaacggcaccggcgccaacgtgctcgcgctccagtcgtgcctg
ccgcgctggggagcggtcatctgctcgagcggcgcgcacatccaggtcgacgagggcggc
gcccccgagcgcgtcggcggcctcaagctgctcacggtgccgacgcccgacggcaagctg
acgcccgagctcgtcgatcgcgaggcgtggggattcggcgacgagcaccgcgcgcagccg
ggcatcgtgtcgatcacccagtcgacggagatcggcacgctgtacacggccgacgagatc
cgagccctcgccgaccacgcgcacgagcgcggcatgctgctgcacgtcgacggcgcgcgc
atcgccaacgcggcggccgcgctcgacgcgccgctgcatgccttcctcaccgacgcgggc
gtcgacatcctctccctcggcggcacgaaggacggcgcgctcgccgccgaggccgtcgtg
acgctctcggagcgcgcgggcgccgggctcacgtacctgcgcaagctcgacatgcagctc
gcgtcgaagatgcgcttcctctcggcgcagctgctcgccctctacgacggcgacgtctgg
ctcgagaacgcacggcacgcgaacgcgatggcggcacggctgcgcgcggcgctcgagggc
gtcgacggcgtggacttcgtgcagcccacgcaggcgaacggcgtcttcgcgcacctcccc
gccggcgtcgcggatcgcgtgcgcgagtcgttcatgttctacgactggaacggcacctcg
ggcgaggtccgctggatgtgctcgtgggacacgacggaggccgacgtggatgcgttcgcc
gcggcggtgcgcgcggcggtggcgtcggcgtag

DBGET integrated database retrieval system