KEGG   Arachidicoccus ginsenosidivorans: FSB73_05600Help
Entry
FSB73_05600       CDS       T06150                                 

Definition
(GenBank) hypothetical protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
agi  Arachidicoccus ginsenosidivorans
Pathway
agi00040  Pentose and glucuronate interconversions
agi00053  Ascorbate and aldarate metabolism
agi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FSB73_05600
   00053 Ascorbate and aldarate metabolism
    FSB73_05600
Enzymes [BR:agi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     FSB73_05600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: QEC71230
UniProt: A0A5B8VIB5
Position
1368881..1369402
Genome map
AA seq 173 aa AA seqDB search
MLASTDAGSDGLHASPSLARVTADSFIHNSALKTEVFGPFSLLVVARDQQELIEALRSLD
GQLTASLFGTDRDLTDQQGLNPLLDILTGIAGRVIFNEVPTGVEVCHAMVHGGPFPATSS
SSYSSVGTSAILRWVRPVCYQNLPDNLLPDALKNSNPLGIFRQINGNWTKNQL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
ttgttagcaagcacggacgctgggagtgatgggctccatgcaagcccctcactggcaagg
gtcacagcggatagttttatccataacagcgcacttaaaacagaagtattcgggcctttt
tcattactggtggtggctagagaccagcaggagcttatagaggcactccgcagtctggac
ggacaattaacagccagtctttttggaaccgatcgtgatcttacagaccaacaaggtctt
aatccgctactggatatactcaccgggatcgccgggcgggtcatttttaatgaagtacct
acgggtgtggaagtctgtcatgcgatggtgcatggtggtccttttcctgctacttcttcc
agcagttattcctcggtgggcacctcggccatactgcgctgggtaagaccggtttgttat
caaaatctccctgataatttattaccggacgccctcaaaaatagcaatccattgggcatt
ttcaggcaaatcaatggcaactggacaaaaaatcaactttaa

DBGET integrated database retrieval system