KEGG   Akkermansia glycaniphila: PYTT_0641Help
Entry
PYTT_0641         CDS       T04551                                 

Definition
(GenBank) pyridoxal phosphate-dependent transferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
agl  Akkermansia glycaniphila
Pathway
agl00860  Porphyrin and chlorophyll metabolism
agl01100  Metabolic pathways
agl01110  Biosynthesis of secondary metabolites
agl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:agl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PYTT_0641
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:agl01007]
    PYTT_0641
Enzymes [BR:agl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     PYTT_0641
Amino acid related enzymes [BR:agl01007]
 Aminotransferase (transaminase)
  Class III
   PYTT_0641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: SEH77376
UniProt: A0A1C7PAV1
Position
I:779187..780473
Genome map
AA seq 428 aa AA seqDB search
MNTSLSQQLFTRGKAVIPGGVNSPVRAFKLVDGTPFFVRSAKGAHLRDEDGNDYIDYIGT
WGPAILGHAPDKIIAAVGDAITRGLGYGTPTAVEVDMAETIVRWIPSIDKVRMTSSGTEA
TMSAIRLARGYTGRKYIIKFEGCYHGHVDSLLVSAGSGALTCGKPDSAGVPDAFAALTIA
LPYNDKEAVRQAFAAHGSDIAAIILEPYPANAGLYFPKDNFLEYLRDITARHGALLIFDE
VMTGFRLGKDGVQGIHGITPDITCLGKVIGGGLPVGAFGGRADIMDCVSPLGPVYQAGTL
SGNPIAMTAGLTQLRELENTDAYSRLENLGARLEEGIRKALADTGNPFTFHRTGSMFCLF
FTAKEVNNLQDAMTASLEQYRPFFRSLLEQGVYFAPSPYETGFISAAHTESDIDHTVAAV
ARALKSIG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctccctgtctcagcaactcttcacccgcggcaaggccgtcatccccggaggg
gtcaactcccccgtccgcgccttcaaactcgtcgatggcacccccttcttcgtccgctcc
gccaagggagcccacctgcgcgatgaagacggcaacgactacatcgactacatcggcaca
tggggccccgccatcctcggccatgcgccggacaaaatcatcgccgccgtaggagacgcc
atcacgcggggactgggatacggcacacccaccgccgttgaagtggacatggcggaaacc
atcgtccgctggataccctccatcgacaaagtccgcatgaccagcagcggcacggaagcc
accatgtccgccatccggctggctcgcggctacacgggccggaaatacatcatcaaattc
gaaggctgttaccacggccatgtcgactccctcctcgtctccgccggatccggagccctc
acctgcggcaagccggacagcgcaggcgtacccgatgccttcgccgccctcaccatcgcc
ctgccctacaacgacaaggaagccgtccggcaggcattcgccgcgcacggcagcgacata
gccgccatcatcctcgaaccctacccggccaatgccggcctatacttcccgaaggacaac
ttcctcgaatacctgcgcgacatcaccgcacgccacggcgccctcctcatcttcgacgaa
gtcatgaccggcttccgcctcggcaaagacggcgtacagggcatccacggcatcacgccg
gacatcacctgcctcggcaaagtcatcggcggaggcctccccgtcggagccttcggcggc
cgggcggacatcatggactgcgtctcccccctcggtcccgtctaccaggcaggcaccctc
tccggcaaccccatcgccatgacagcgggcctcactcaactgcgcgaactggaaaacacc
gatgcctactcccggctggaaaacctcggcgcacgcctcgaagaaggcatccgcaaagct
cttgcggacacgggcaaccccttcaccttccaccgcaccggatccatgttctgcctcttc
ttcaccgcaaaagaagtcaacaacctgcaggatgccatgaccgcctcactggagcaatac
cgccccttcttccgctccctgctggaacaaggagtttactttgccccctcgccgtacgaa
acggggttcatctccgccgcccacacggaaagcgacatcgatcacacggtcgcagccgtt
gcacgagccctgaaatcaatcggctga

DBGET integrated database retrieval system