KEGG   Akkermansia glycaniphila: PYTT_0813Help
Entry
PYTT_0813         CDS       T04551                                 

Definition
(GenBank) apag domain
  KO
K06195  ApaG protein
Organism
agl  Akkermansia glycaniphila
Brite
KEGG Orthology (KO) [BR:agl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PYTT_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: SEH79644
UniProt: A0A1H6KUQ9
Position
I:981369..981767
Genome map
AA seq 132 aa AA seqDB search
MDNIKSQPIPTEDYLDIQLTMAGIRLPDTSGGNYQIAFRILLSNTSERSVRLLGRKWILR
DQSGQTRLIEADGIFNQHPLLQPGDVFAYTGRQTFTELPTRMEVMFFGLNQAGFPFISPS
FIFPKKTYQAGK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggacaacattaaatcacaaccgatccccaccgaggactatctggacatccagctcacc
atggcaggcatacgcctgcccgacacctccggcggcaactaccagatcgccttccgcatc
ctcctgagcaacacttccgaacgctccgtccgccttctggggcgtaaatggatcctgcgc
gaccagtcagggcaaacccgcctcatcgaagcggacggcatcttcaaccagcatccgctc
ctccagccgggcgacgtcttcgcctatacaggtcgacaaaccttcaccgaactgcccacc
cgcatggaagtcatgttcttcggtttaaaccaggccggatttcccttcatctccccctcg
ttcatctttcccaaaaagacttatcaggccggtaaatag

DBGET integrated database retrieval system