KEGG   Akkermansia glycaniphila: PYTT_1072Help
Entry
PYTT_1072         CDS       T04551                                 

Definition
(GenBank) trub: trna pseudouridine(55) synthase
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
agl  Akkermansia glycaniphila
Brite
KEGG Orthology (KO) [BR:agl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:agl03016]
    PYTT_1072
Enzymes [BR:agl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     PYTT_1072
Transfer RNA biogenesis [BR:agl03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    PYTT_1072
 Prokaryotic Type
    PYTT_1072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2
Motif
Other DBs
NCBI-ProteinID: SEH83150
UniProt: A0A1C7PD61
Position
I:complement(1248738..1249466)
Genome map
AA seq 242 aa AA seqDB search
MKVQDSSISGVLLIDKAQDMTSHDVVAIARRALNTKKIGHCGTLDPMATGLLMLVVGKAT
KLQDLLMCEDKVYEATMLLGVETDSQDAEGDVVATRPTDGVTPEAVREAFTRFAGAFEQV
PPMVSAIKKNGVPLYKLARKGQVVEREPRPVKVLDYEVRRVELPEVDFTVHCSKGFYVRT
YAHDIGQVLGCGAHLTALRRVRSGHFSVDGAMPVEFLKSAPREEVVKGLLSIEQIAAMRG
VL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtacaggattcttccatcagcggggtgttgttgatcgacaaggcgcaggatatg
acgtcgcacgatgtggtggcgatcgcccggcgtgcgctcaatacgaaaaagatcgggcat
tgcggtacgctggatccgatggcgacggggctgctgatgctggtggtcggcaaggcgacg
aagcttcaggatctgctgatgtgcgaggataaggtgtacgaggcgacgatgctgctcggt
gtggagacggatagtcaggatgccgagggcgatgtggttgcgacgcggccgacggacggc
gtgacgccggaggcggtgcgcgaggcgttcacgcggttcgcgggagcgttcgagcaagtt
ccgccgatggtttccgcgattaagaagaatggcgtgccgctgtacaagctggcgcgcaag
gggcaggtggtggagcgcgagccgcgtccggtgaaggtgctggattacgaggtgcgccgc
gtggagctgcccgaggtggattttacggtgcattgttcgaagggtttttacgtgcgtact
tatgcgcatgatatcggtcaggtgttgggttgcggtgcgcatttgacggctttgcgccgg
gtgcggtcgggtcatttttctgtggatggagccatgcctgtggagtttttgaagtccgcg
ccgcgcgaggaggtggtgaaggggctgttgtcgatcgaacagattgccgcgatgcgaggc
gttctttga

DBGET integrated database retrieval system