KEGG   Agromyces sp. MF30-A: DCE93_02155Help
Entry
DCE93_02155       CDS       T05411                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
agm  Agromyces sp. MF30-A
Pathway
agm00620  Pyruvate metabolism
agm00630  Glyoxylate and dicarboxylate metabolism
agm01100  Metabolic pathways
agm01110  Biosynthesis of secondary metabolites
agm01120  Microbial metabolism in diverse environments
agm01200  Carbon metabolism
Module
agm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:agm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DCE93_02155
   00630 Glyoxylate and dicarboxylate metabolism
    DCE93_02155
Enzymes [BR:agm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DCE93_02155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AWB94614
UniProt: A0A2S0WTP8
Position
458917..460590
Genome map
AA seq 557 aa AA seqDB search
MTFERADAAASGSQFEPKPATGSFQTVEPRIEITAPLGERYDEILTPEALAFLAELHDRF
AGTRHELLAARLQTRVDAANGRDPKFLPETEWIRDDSSWRVAGAGPGLEDRRVEITGPTD
RKMAINALNSGAKVWLADQEDATSPTWPNVIEGQLSLFDALRGRLEFTSPEGKQYRVTAE
ETPTIVMRPRGWHLVEKHLKFHDRAGRAMHASGSLVDFGLYFFHNAQALIAAGRGPYFYL
PKLESHHEARLWNDIFVFAQTRLGIPQGTVRATVLIETIQAAFEMDEILYELRDHCAGLN
AGRWDYIFSIVKTFRSRGRRWVLPDRKAITMTVPFMRAYTELLVATCHKRGAHAIGGMSA
FIPNRRDPEVTARALAAVSADKRREAGDGFDGTWVAHPDLIPTARAEFDAVLGDKPNQLD
RLRDDVHVTAAELLDIPSIGGEVTEGGVQDNISIGIRYIESWLRGTGAAAIDNLMEDAAT
AEISRSQVWQWLNENTVTAEGTRIDQTSIVRLMAAAVAELPRFEGDRFDDAISVFRTVAL
EPEFPTFLTVGAYARFL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgagcgagcggatgccgcggcatccggatcccagttcgagccgaagcccgcc
accggcagcttccagaccgtcgaaccgcgcatcgagatcaccgcgccgctcggtgagcgc
tacgacgagatcctcacgcccgaggcgctcgcgttcctcgccgagctgcacgaccgcttc
gccggcacccggcacgagctgctcgccgcacgcctgcagacccgggtcgatgccgccaac
ggtcgcgacccgaagttcctgcccgagacggagtggatccgcgacgacagcagctggcgc
gtcgccggcgccgggcccggcctcgaggaccgccgcgtggagatcaccggaccgaccgac
cgcaagatggcgatcaacgcgctgaactcgggcgcgaaggtctggctcgccgaccaggag
gacgcgacgagcccgacctggccgaacgtcatcgagggccagctgagcctcttcgacgcg
ctgcgcggccgcctcgagttcacgagccccgaaggcaagcagtaccgcgtcaccgcggag
gagacgccgacgatcgtgatgcgaccgcgcggctggcacctcgtcgagaagcacctgaag
ttccacgaccgtgcggggcgcgcgatgcacgcctcgggctcgctcgtcgacttcggcctg
tacttcttccacaacgcgcaggcgctcatcgccgcggggcgcgggccgtacttctacctg
ccgaagctcgagtcgcaccatgaggcccggctgtggaacgacatcttcgtcttcgcccag
acgcggctcggcatcccgcagggcacggtgcgggcgacggtgctgatcgagacgatccag
gccgcgttcgagatggacgagatcctctacgaactgcgcgaccactgcgcgggcctgaac
gccggccgctgggactacatcttctcgatcgtgaagacgttccgttcgcgcggtcgccgc
tgggtgctgcccgaccgcaaggcgatcacgatgacggtgccgttcatgcgggcctacacc
gagctgctcgtcgcgacgtgccacaagcgcggcgcgcacgccatcggcggcatgagcgcg
ttcatcccgaaccgccgcgaccccgaggtgaccgcccgtgcgctcgccgcggtgtcggcc
gacaagcgccgggaggccggcgacggcttcgacggcacgtgggtcgcgcaccccgacctg
atccccacggctcgggcggagttcgacgcggtgctcggcgacaagccgaaccagctcgac
cgcttgcgcgatgacgtgcacgtgaccgcggccgagctgctcgacatcccgtcgatcggc
ggcgaggtcaccgagggcggcgtgcaggacaacatctcgatcggcatccgctacatcgag
tcgtggctgcgcggcacgggcgccgcggcgatcgacaacctcatggaggatgccgcgacg
gccgagatctcgcgttcgcaggtctggcagtggctcaacgagaacacggtcacggccgag
ggcacccgtatcgaccagacgtcgatcgttcggctcatggcggccgcggtcgccgaactg
ccgcgcttcgagggcgaccggttcgacgacgcgatctcggtgttccgcaccgtcgccctc
gagcccgagttcccgacgttcctcacggtgggcgcctacgcgcgcttcctctga

DBGET integrated database retrieval system