KEGG   Agromyces sp. MF30-A: DCE93_04400Help
Entry
DCE93_04400       CDS       T05411                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
agm  Agromyces sp. MF30-A
Brite
KEGG Orthology (KO) [BR:agm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DCE93_04400
Enzymes [BR:agm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     DCE93_04400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AWB94996
UniProt: A0A2S0WUG7
Position
919124..919975
Genome map
AA seq 283 aa AA seqDB search
MQSTTEGFGVAVAQFAPNDDVARNRSELTRLAELAVARGARLVVFPEYSSYFTPEPGEDW
STAAEPLDGAFATHLSALADRLGVHLVAGMIERRDSDRDRGHDRDRGSGRRVANTVVALA
PGAGIVARYRKLHLYDAFGQQESAWVEPGAIEPPETFEAGGIRFGLQTCYDARFPEVTRR
IVDAGADVVCMPAEWVRGPLKEAHWRVLTTARALENTVYVAAADQAPPMGAGNSMIVDPM
GVELATIGEATDVAVAWISKERIDAVRRVNPALALRRFDVIPR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcacgaccgaagggttcggcgtcgcagtcgcccagttcgcgccgaacgacgac
gtcgcccgcaatcgcagcgaactcacccgcctcgccgagctcgcggtcgcacgcggcgcc
cgactcgtcgtctttcccgagtactcgagctatttcacgcccgaaccaggcgaggactgg
tcgaccgcggccgaaccgctcgacggcgcgttcgccacgcatctctccgcgctcgccgac
cgcttgggcgtgcacctcgtggccggcatgatcgagcgccgcgacagcgaccgcgaccgc
ggtcacgaccgcgaccgcggcagcggccggcgggtcgccaacacggtcgtcgcgctcgca
cccggcgccggcatcgtggcccggtaccgaaagctccacctctacgacgccttcgggcag
caggaatctgcctgggtcgaaccgggcgcgatcgaaccgcccgagacgttcgaggccggc
ggcatccgcttcggcctgcagacctgctacgacgcgaggttccccgaggtcacgcggcgc
atcgtcgacgccggtgccgatgtcgtctgcatgcccgccgagtgggtgcgcggtccgctg
aaagaggcgcactggcgggtgctcaccacggccagggcgctcgagaacaccgtctacgtc
gcagcggccgaccaggcgccgcccatgggtgcgggcaacagcatgatcgtcgacccgatg
ggtgtcgagctcgccacgatcggcgaggcgacggatgtcgcggtggcctggatctcgaag
gagcgcatcgacgcggtgcgccgggtgaaccccgccctcgcgctgcgccggttcgacgtc
atcccgcgctga

DBGET integrated database retrieval system