KEGG   Agromyces sp. MF30-A: DCE93_05265Help
Entry
DCE93_05265       CDS       T05411                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
agm  Agromyces sp. MF30-A
Brite
KEGG Orthology (KO) [BR:agm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DCE93_05265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AWB95140
UniProt: A0A2S0WV09
Position
1109707..1110885
Genome map
AA seq 392 aa AA seqDB search
MDLTLIVVLVIVLALFFDFTNGFHDTANAMATPIATGALKPKVAVGLAAILNLIGAFLST
EVAKTISGGIIKEGDGGVLITPELIFAGLIGAIVWNMITWLLGLPSSSSHALFGGLIGAA
LVGFGVGAIDFAVVLSKVILPALLAPLTAGLIAFTATKLAYAITRRYDGKPDGRDGFRHA
QVFSSSLVALAHGTNDAQKTMGVITLTLVAAGLQPAGGEVPWWVIVTCAIAIALGTYMGG
WRIIKTLGTGLTDVKPAQGFAAETATAATILASSHVGFALSTTQVASGSVIGSGLGRRGS
KVRWRTAGRIGVGWLLTLPAAGGVGALAAFVAHLGVVGIIIDAIIGVAVIAGIFLWSRRN
EVSHHNVVSEVAHSGRAVKIKRNPKPKKKVAS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcaccctcatcgtcgtgctggtcatcgtactggcgctcttcttcgacttcacc
aacggattccacgacaccgccaacgccatggccactcccatcgccacgggagcgctcaag
ccgaaggtcgccgtcggactcgccgcgatcttgaacctcatcggcgcattcctctcgacc
gaggtggccaagaccatctcgggcggcatcatcaaagagggcgacgggggagtgctgatc
acccccgagctcatcttcgcggggctcatcggcgcgatcgtgtggaacatgatcacctgg
ctgctcggcctgccctcctcatcgagccacgcgctcttcggcggcctgatcggcgcggcg
ctcgtcgggttcggcgtcggcgcgatcgacttcgccgtcgtgctgtcgaaggtcatcctg
cccgcgctgctggcgccgctcaccgccggactcatcgccttcaccgcgacgaaactcgcc
tacgcgatcacccgccgctacgacggcaagcccgacggccgtgacggcttccggcacgcc
caggtgttctcctcctctctcgtcgcgctcgcgcacggcaccaacgacgcgcagaagacg
atgggcgtcatcacgctcaccctcgtcgccgcggggctgcagccggcgggcggcgaagtg
ccgtggtgggtcatcgtgacctgcgccatcgcgatcgcgctcggcacctacatgggcggc
tggcgcatcatcaagacgctcggcaccgggctcaccgatgtgaagcccgcgcagggcttc
gccgccgagacggccacggccgcgacgatcctcgcgtcgagccacgtgggcttcgcgctg
tcgaccacgcaggtcgcctctgggtcggtcatcggctcggggctcggccgtcgcggctcg
aaggtgcgctggcgcacggccggccgcatcggcgtcggctggctcctgaccctgcccgcc
gccggcggcgtcggcgccctcgccgcgttcgtcgcccacctcggcgtcgtcggcatcatc
atcgacgccatcatcggcgtcgccgtcatcgccggcatcttcctctggtcgcgtcgcaac
gaggtctcccaccacaacgtggtgagcgaagtggcccactccggccgcgccgtcaagatc
aaacgcaacccgaagccgaagaagaaggtggcctcgtga

DBGET integrated database retrieval system