KEGG   Agromyces sp. MF30-A: DCE93_06840Help
Entry
DCE93_06840       CDS       T05411                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
agm  Agromyces sp. MF30-A
Pathway
agm00270  Cysteine and methionine metabolism
agm00480  Glutathione metabolism
agm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DCE93_06840
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DCE93_06840
Enzymes [BR:agm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     DCE93_06840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP RimK GSH-S_N ATPgrasp_YheCD ATP-grasp_3 GSP_synth CP_ATPgrasp_2 TTL
Motif
Other DBs
NCBI-ProteinID: AWB95409
UniProt: A0A2S0WVP1
Position
complement(1432237..1433235)
Genome map
AA seq 332 aa AA seqDB search
MRLAFLVNDVDTEVDEYTTTRLARAAARGGHETWYVGVGDLERGSSDGLFSAMARAARWK
SDDTLASFMEGIKARDAERIVMDDLDALVLRNESIDDLQDRPWASPMGVVFGQMLADRGV
TVVNDPNALHRATSKLYLEEFPEKVRPRSLVTRDPEAIERFVDEVGHCVVKPLYGAKGRN
VFMIEGPGETNLAQMTEAVLQDGYAIIQEFIDGAKDGDARIFLLEGRILECDGRPAAFRR
VPTGNDPRANISTGGRSVPLEVGEAELGIVEAVGDKLVADGMFLVGIDVIGSQVVEINAE
SPGGFQSIERLYDIDIAETVIEALERRVSPGS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcgcatttctcgtcaacgacgtcgacaccgaggtcgacgagtacacgaccacc
cgactcgccagggccgcagccaggggcgggcacgagacctggtatgtcggcgtcggggac
ctcgagcgcggcagcagcgacgggctgttctcggccatggctcgcgccgcgaggtggaag
agcgacgacaccctcgcgagcttcatggaggggatcaaggcgcgcgacgccgagcggatc
gtcatggacgacctggatgcgctcgtcctgcgcaacgagtcgatcgacgacctgcaggac
cgcccctgggccagcccgatgggcgtggtgttcggacagatgctcgcggaccgaggtgtc
acggtggtcaacgacccgaacgccctccatcgagcgaccagcaagctctacctggaggag
ttccccgagaaggttcgaccacggtcgctggtgacacgagatcccgaggcgatcgagcgg
ttcgtcgacgaagtcggccactgcgtcgtcaaaccgctatacggggccaagggccgcaac
gtcttcatgatcgagggcccgggagagaccaacctcgcgcagatgacggaggcggtcctg
caggacggctacgccatcatccaggagttcatcgacggagccaaggacggcgatgcccgg
atcttcctgctggagggccgcattctcgagtgcgacggcaggccggccgccttccgacgc
gtgcccaccggcaacgacccccgcgccaacatcagcaccggcggtcggtcggtgcccctc
gaggtcggtgaggccgagctcggcatcgtcgaggcggtgggcgacaagctcgtcgccgat
ggcatgttcctcgtgggcatcgacgtgatcggcagccaggtggtggagatcaacgcggag
agtcccggcggcttccagagcatcgagaggctctacgacatcgacatcgcagagaccgtc
atcgaagccctggagcgccgcgtgagcccggggtcctga

DBGET integrated database retrieval system