KEGG   Agromyces sp. MF30-A: DCE93_07700Help
Entry
DCE93_07700       CDS       T05411                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
agm  Agromyces sp. MF30-A
Pathway
agm00480  Glutathione metabolism
agm00590  Arachidonic acid metabolism
agm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    DCE93_07700
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DCE93_07700
Enzymes [BR:agm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DCE93_07700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AWB95558
UniProt: A0A2S0WW82
Position
complement(1615310..1615807)
Genome map
AA seq 165 aa AA seqDB search
MDIREIPLTTIDGDATSLGDYADQVVMIVNVASRCGLTPQYEKLEELQREYGDRGFTVLG
FPCNQFAGQEPGDGDDIKEFCSMTYGVTFPLMEKAKVNGRHRHPLYAELTTVTDADGKAG
RVKWNFEKFVVQPGGQVVRFRPTTLPDDPAVIAAIEEGLAQAKAA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcagagagatccccctgacgacgatcgacggcgatgcgacctccctcggcgat
tacgccgaccaggtcgtgatgatcgtgaacgtcgcgtcgaggtgcggcctcacgccgcag
tacgagaagctcgaggagctgcagcgcgagtacggcgaccgcgggttcacggtgctcggc
ttcccgtgcaaccagttcgcagggcaggagccgggtgacggcgacgacatcaaggagttc
tgctcgatgacgtatggcgtgaccttcccgctcatggagaaggccaaggtcaacgggcgt
caccggcatccgctctacgccgaactcaccacggtgaccgacgccgacggcaaggccggt
cgcgtgaagtggaacttcgagaagttcgtcgtgcaaccgggtgggcaggtggtgcgattc
cgcccgaccacgctgcccgacgatccggccgtgatcgccgcgatcgaagaaggcctcgcc
caggcgaaggccgcctga

DBGET integrated database retrieval system