KEGG   Agromyces sp. MF30-A: DCE93_10095Help
Entry
DCE93_10095       CDS       T05411                                 

Gene name
cobA
Definition
(GenBank) uroporphyrinogen-III C-methyltransferase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
agm  Agromyces sp. MF30-A
Pathway
agm00860  Porphyrin and chlorophyll metabolism
agm01100  Metabolic pathways
agm01110  Biosynthesis of secondary metabolites
agm01120  Microbial metabolism in diverse environments
Module
agm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:agm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DCE93_10095 (cobA)
Enzymes [BR:agm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     DCE93_10095 (cobA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     DCE93_10095 (cobA)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     DCE93_10095 (cobA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase
Motif
Other DBs
NCBI-ProteinID: AWB95971
UniProt: A0A2S0WXE3
Position
complement(2127252..2128046)
Genome map
AA seq 264 aa AA seqDB search
MTTPPIPAPGRVTLVGAGPGDPGLLTIRGLRALEAADVVVADRLGARGVLDGLAAEGVTL
RAEVVDVGKLPGHHAVPQDAINELLVALARDGKRVVRLKGGDPFIFGRGGEEVAFCHDAG
VDVEVVPGITSAISVPAIAGIPLTHRGLATTFTVVTGHDQIQALGGGRDHTVVLLMGIGT
LANSAITLARGERGVDCPVAVVEDGYGPRQRVTVGTLGTIALQAARRGIRSPAVVVVGDV
VTLSPYAPEAIASGAGRAPRSTAP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgccgcccatcccggcaccgggccgcgtcaccctcgtgggcgccgggccgggt
gaccccggactcctcacgatccgcggactgcgcgcactcgaggccgccgatgtcgtcgtc
gccgaccggctcggcgcgcgcggggtcctcgacgggctcgccgccgagggtgtcacgctc
cgcgccgaggtcgtcgacgtcggcaagctgcccggccaccacgccgtgccgcaagacgcg
atcaacgagctgctcgtcgccctcgcccgcgacggcaagcgcgtcgtgcgcctgaagggc
ggcgacccgttcatcttcggccgtggcggcgaggaagtcgcgttctgtcacgacgccggt
gtcgacgtcgaggtcgtacccggcatcacgagcgccatctcggtgcccgcgatcgccgga
atcccgctcacgcatcgcggcctcgcgacgaccttcaccgtcgtcaccgggcacgaccag
atccaggcgctcggcggcggccgcgaccacaccgtggtgctcctcatgggcatcggcacg
ctcgcgaactcggcgatcaccctcgcccggggtgagcgcggcgtagactgccccgtcgct
gttgtcgaagacggctacgggcctcgccagcgggtgaccgtgggcacgctcggcacgatc
gcgctgcaggcggcacgccgcggcatccgctcgcccgcggtcgtcgtcgtcggcgacgtc
gtgacgctcagcccgtacgcgcccgaggcgatcgcctccggcgccgggcgggcaccgcgc
tcgaccgctccctag

DBGET integrated database retrieval system