KEGG   Agromyces sp. MF30-A: DCE93_12270Help
Entry
DCE93_12270       CDS       T05411                                 

Definition
(GenBank) phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
agm  Agromyces sp. MF30-A
Pathway
agm00030  Pentose phosphate pathway
agm01100  Metabolic pathways
agm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:agm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DCE93_12270
Enzymes [BR:agm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     DCE93_12270
    4.1.2.22  fructose-6-phosphate phosphoketolase
     DCE93_12270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP XFP_C TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AWB96328
UniProt: A0A2S0WYE2
Position
2597550..2600030
Genome map
AA seq 826 aa AA seqDB search
MAQAGEQHQQHQHDPRVASSERRREASVPLEIVDAWWRAANYLSVGQIYLMANPLLARPL
EPADIKPRLLGHWGTSPGLNLVYAHLNRAIVERGTPTIYVCGPGHGGPAMVANTWLDGTY
SELFPAVSADVEGMGRLFRQFSFPGGIPSHAAPETPGSINEGGELGYSLMHAYGAALDNP
GLVVACVIGDGEAETGPLAASWRGHSFLNPVTDGAVLPILHLNGYKIANPTLLARIPEAE
LVDFFRGNGYEPLLVAGGFDGEDPMAVHGRMADAIDVAYERIAAIRVDAAAGAFADVAPR
WPAIVLRTPKGWTGPGVVDGVQVEGTFHAHQVPLAGVRENPEHLAMLEAWLRSYRPEELF
DGEGRPVAELAAARPDGALRMSANESAHVNGGIAAPLELPAIEPLAIEVAPGKRGTTGEA
TRVFGSWLAEVMRRNPDDFRLFGPDEVASNRLGAVFEVTDRVWAEALHPLDDHLGRSGRV
VEALSEHLMQGLLEGYLLTGRHGLITSYEAFIHIVDSMFNQHAKWLESAKQVPWRGDVAS
LTYLLSSHVWRQDHNGFSHQDPGFLNVVVNKQAEIVRVYLPPDANTLLEVMRHAFDTQNR
VNVVVAGKQPQPQWLSHTEARAHVEAGLGVWEWAGNEPGFERADAAASVPDVVIACAGDV
PTTEAIAAAQLLRGRLPELRVRLVNVVDLMRLQDPSHHPHGLPDRAFDAIFTRSAPVIFA
FHGYPPLIHQLAYRRTNHTNLHVRGFIERGTTTTPFDMLHLNDLDRYRLALDVLHRVPGL
HSRPGVAEIADEWHAARNAAREHAYEYGADPEWITGWRFAPRAAAE
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagcaggcgagcagcatcagcagcaccagcacgacccgcgggtcgcgtcgagc
gagcgccggcgcgaggcatccgtaccgctcgaaatcgtcgacgcgtggtggcgcgccgcc
aactacctgagcgtcggccagatctacctgatggcgaacccgctgctggcccgccccctc
gaaccggccgacatcaagccgcggctgctcgggcactggggcacctcccccggcctgaac
ctcgtgtacgcgcacctcaatcgcgcgatcgtcgagcgcggcacgcccacgatctacgtg
tgcgggcctggccacggcgggcccgcgatggtcgcgaacacgtggctcgacggcacctac
tccgaactcttcccggcggtgagcgccgacgtcgagggcatgggccgcctgttccggcag
ttctccttccccggcggaatcccgtcgcacgcggcgcccgagacgcccggctcgatcaac
gagggcggcgaactcggctactcgctcatgcacgcctacggcgcggcactcgacaatccg
gggctcgtggtcgcctgcgtcatcggcgacggcgaggccgagaccggccccctcgcggcg
agctggcgcggtcactccttcctgaaccccgtgaccgacggcgcggtgctgccgatcctg
cacctgaacggctacaagatcgcgaacccgaccctgctcgcgcgcatccccgaagccgag
ctcgtcgacttcttccgcggcaacggctacgaaccgctgctcgtcgccggcgggttcgac
ggcgaggacccgatggcggtgcacggccgcatggccgacgcgatcgacgtcgcctacgag
cgcatcgccgccattcgagtggatgccgcggcgggcgcgttcgccgacgtggcgccccgc
tggccggcgatcgtgctgcgcaccccgaagggctggacgggacccggcgtggtcgacggc
gtgcaggtcgagggcacgttccacgcccatcaggtgccgctcgcgggcgtgcgcgagaac
cccgagcacctcgcgatgctcgaggcgtggctgcgctcctaccggccggaggagctcttc
gacggcgagggccgccccgtcgccgagctcgctgccgcgcgccccgacggggcgctgcgc
atgagcgcgaacgagagcgcccacgtcaacggcggcatcgcggccccgctcgagctgccg
gcgatcgaaccgctcgcgatcgaggtcgcacccggcaagcgcggcaccaccggcgaggcc
acgagggtcttcggctcctggctcgccgaggtgatgcgcaggaaccccgacgatttccgc
ctcttcggccccgacgaggtggcctcgaaccggctcggcgccgtcttcgaggtcaccgat
cgggtgtgggccgaggcgctgcatccgctcgacgaccacctcgggcgctcgggccgggtg
gtcgaagcgctcagcgagcacctcatgcaggggctgctcgaggggtacctgctgacgggg
cggcacgggctcatcacgagctacgaggcgttcatccacatcgtcgactcgatgttcaac
cagcacgcgaagtggctcgagtcggcaaagcaggtgccatggcgcggggatgtcgcaagc
ctcacctacctgctctcgtcgcacgtgtggcggcaggaccacaacggcttctcgcatcag
gatccgggcttcctgaacgtcgtcgtcaacaagcaggccgagatcgtgcgcgtgtacctg
ccgcccgacgcgaacaccctgctcgaggtcatgcggcacgccttcgacacgcagaaccgg
gtcaacgtcgtcgtcgcgggcaagcagccgcaaccgcagtggctctcgcacaccgaggcg
cgagcgcacgtcgaggccggtctcggcgtgtgggagtgggcgggcaacgaacctggcttc
gagcgagcggatgccgcggcatccgtgcccgacgtcgtcatcgcgtgcgccggcgacgtg
ccgacgaccgaggcgatcgcggcggcgcaattgctgcgcgggcggttgcccgagctgcgg
gtgcggctcgtcaacgtcgtcgacctgatgcgactgcaggacccgtctcaccacccccac
gggctgcccgaccgggcgttcgacgcgatcttcactcgctcggcgcccgtgatcttcgcg
ttccacggctacccgccgctgatccaccagctcgcctaccggcgcacgaaccacacgaac
ctgcacgtgcggggcttcatcgagcggggcaccacgacgaccccgttcgacatgctgcac
ctgaacgacctcgaccggtaccggctcgcgctcgacgtgctgcaccgcgttccggggctc
cacagccggccgggtgtcgccgagatcgccgacgagtggcacgccgcccggaacgccgcg
cgggagcatgcgtacgagtacggcgccgaccccgagtggatcaccgggtggcggttcgct
ccgcgggccgccgccgagtga

DBGET integrated database retrieval system