KEGG   Agromyces sp. MF30-A: DCE93_14150Help
Entry
DCE93_14150       CDS       T05411                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
agm  Agromyces sp. MF30-A
Pathway
agm00010  Glycolysis / Gluconeogenesis
agm00020  Citrate cycle (TCA cycle)
agm00620  Pyruvate metabolism
agm01100  Metabolic pathways
agm01110  Biosynthesis of secondary metabolites
agm01120  Microbial metabolism in diverse environments
agm01130  Biosynthesis of antibiotics
agm01200  Carbon metabolism
Module
agm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:agm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DCE93_14150
   00020 Citrate cycle (TCA cycle)
    DCE93_14150
   00620 Pyruvate metabolism
    DCE93_14150
Enzymes [BR:agm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DCE93_14150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AWB96647
UniProt: A0A2S0WZ59
Position
complement(3007326..3008804)
Genome map
AA seq 492 aa AA seqDB search
MSEIRFPLPDVGEGLTEAEIVQWHVAPGDRISLDQVFVEIETAKSLVELPSAFEGVVAEL
LVAEGATVDVGTPILVIQTDAAGLASGTPGGGAGAGAVAAPAQPAPPASTAPPVSTPVQA
SAAVAAPTVAASADEGGGAVLVGHGSSGPAATRRRRHPTPDGAHGHLAAPAPTPPAPPAP
TRSSGPATGSAATSAAAAVTTRPAARVPVIAKPPIRKLAKDLGVDLSRVAPTGPIGDITR
DDVIREASQASVFRNIQTPERPEGREERIPVKGVRKVIANAMVQSAFQAPHVSVFVDVDA
TRTMEYLKRLKASPDYAGVRISPLLIMAKAMIWAVRRNPTVNAQWTDSEIVVKHYVNLGI
AAATPRGLIVPNVKEAQAMTMVELATALEQLTLTAREGKTQPAEMQGGTITITNIGVFGM
DTGTPILNPGEVAIVALGTIKQKPWVVDGEVRPRFVTTIGASFDHRVVDGDVASRFLADV
ASIIEEPALLLE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagatccgattccccctccccgacgtgggcgaggggctcaccgaggccgagatc
gtgcagtggcatgtcgcgcccggtgatcgcatcagcctcgaccaggtcttcgtcgagatc
gagacggcgaagtcgctcgtcgagctgcccagcgcgttcgagggcgtcgtcgccgaactg
ctcgtcgccgagggcgccaccgtcgacgtcggcaccccgatcctggtgatccagacggat
gccgcggggctcgcctccgggacgccgggcggcggtgccggcgcgggcgccgtggcggcc
ccggcccagcccgctcctccggcctccaccgctcccccggtctcgacgccggtgcaggct
tcagcggccgttgccgcgcccacggttgcggcgtcggccgatgaaggaggcggcgcggtg
ctcgtcgggcacggcagctccggaccggcggcgacccgtcgccgacgtcaccccacgccc
gatggtgcacacggccacctcgcggccccggctcccaccccgccggctccgcccgcgccg
acgcgctcgtcgggcccggcgaccgggtcggccgcgacatccgctgccgccgccgtgacg
acgcgcccggccgcgcgcgtgccggtgatcgcgaagccaccgattcgcaagctcgcgaaa
gacctgggcgtcgatctctcccgcgtcgcgccgaccgggccgatcggcgacatcactcgc
gacgacgtgatccgcgaggcgagccaggcgagcgtcttccgcaacatccagacgcccgag
cggcccgagggtcgcgaggagcgcatccccgtcaagggcgtgcgcaaggtcatcgcgaac
gccatggtgcagagcgcgttccaggctccgcacgtgagcgtgttcgtcgacgtcgacgcc
actcgcacgatggagtacctgaagcggctgaaggcctcacccgactacgcgggcgtgcgc
atctcgccgctgctgatcatggcgaaggcgatgatctgggcggtgcgccgcaaccccacg
gtgaacgcccagtggaccgattccgagatcgtcgtcaagcactacgtgaatctcggcatc
gccgcggcgacgccgcggggcctcatcgtgccgaacgtcaaagaggcgcaggcgatgacg
atggtcgagctcgcgacggcgctcgagcagctcaccctgacggcgcgcgagggcaagacc
cagccggcggagatgcagggcggcacgatcacgatcacgaacatcggcgtgttcggcatg
gacaccggaacgccgatcttgaatccgggcgaggtcgccatcgtcgccctcggcacgatc
aagcagaagccatgggtcgtcgacggtgaggtgcgcccgcgcttcgtgacgacgatcggg
gcctcgttcgatcaccgcgtggtcgacggcgacgtggcgtcgaggttcctcgccgacgtc
gcctcgatcatcgaggaacccgcactgctgctggagtag

DBGET integrated database retrieval system