KEGG   Anoxybacillus gonensis: AFK25_03290Help
Entry
AFK25_03290       CDS       T04000                                 

Definition
(GenBank) cobalamin biosynthesis protein CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00860  Porphyrin and chlorophyll metabolism
agn01100  Metabolic pathways
Module
agn_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:agn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AFK25_03290
Enzymes [BR:agn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AFK25_03290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase_5 SNO
Motif
Other DBs
NCBI-ProteinID: AKS37583
UniProt: A0A0A2SK54
Position
593090..594604
Genome map
AA seq 504 aa AA seqDB search
MRKALPIMFQGTHSDAGKSVIATAFCRIFARNGWKTAPFKSQNMSLNSYVTVDGKEIGRA
QGVQAEAAGVLATTHMNPILIKPSRDQEAQIVVHGKPYKNMQASAYRTEFFHTGLNIIQQ
SLDVLMKQYDRLVIEGAGSPAEVNLNDRELVNMRVARMANAPVVLIGDIERGGVFASLVG
TLQLLDECDRKRVIGVIINKFRGDVALLQPGLRWFEQYTGVPVLGVVPYMHLRIDAEDSV
TLSRYVTKKDDAKAIDVAVIQYPRISNFTDIDPFFAEPDCSVRFVTDASLLGEPDILILP
GSKNTIEDVQFLKETGLFVAIRRLYERSDTIMIGICGGYQMLGERIKDPFHVETPLDEIE
GLSLLAMETTLACEKTTVLCEGILTFQRETFHVSGYEIHMGRSIVKSGEPLISQNGKTDG
CKTKDERVIGTYMHDLFHNDAFRHHLLNDVRRKKQLLPLSTRPLYRQLRMQAFDELANCV
ETSVNVTTIERKMMEFQGGDHHAL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaagcgctgccgattatgtttcaaggaacgcattcagatgcgggaaaaagcgtg
atcgccacggctttttgtcgcatatttgctcgcaacggttggaaaacggcgccatttaaa
tcgcaaaatatgtcgctcaattcatacgtaacggtcgatggaaaagaaatcggacgcgcg
caaggggtgcaggcggaagcggcaggtgtgttagcgacgacgcacatgaatccgatttta
attaagccgagccgcgatcaagaggcgcaaattgtcgtacatggaaaaccgtataaaaac
atgcaagcgagcgcttatcgaaccgagttttttcatacgggattgaacattattcaacag
tcgctcgatgtattgatgaaacaatacgatcgacttgtcattgaaggagcaggaagtcct
gcggaagtaaatttgaacgatcgtgagcttgtgaatatgcgtgtggcgcgcatggcgaat
gcccctgttgttttgattggtgatattgagcgcggaggagtgtttgcgagtttagttggc
acattgcagttgttagatgaatgtgatcgtaaacgtgtcattggggtgatcattaataaa
tttcgcggcgatgttgcgcttcttcagccgggattgcgttggtttgaacaatatacaggc
gtgccggtgcttggcgtcgttccgtatatgcatttgcgcatcgatgcggaagattctgtg
acactttctcgttatgtgacaaaaaaagacgatgcgaaagcgattgatgtagcggtcatt
caatatccgcgcatatctaactttacggatatcgatccgttttttgccgaaccggactgt
tcggtgcgatttgtgacggacgcgtcgttgttaggcgagccagatatacttattttgccg
ggcagtaaaaatacgattgaagatgtccagtttttaaaagaaacagggttatttgtagcg
atccgccgtttatatgaacgaagcgatacgatcatgatcggtatttgcggtggttatcaa
atgcttggagaacgtataaaagatccgtttcatgtcgaaacgccactcgatgagatagaa
ggattaagtttgttggcaatggaaacgacgcttgcttgtgaaaaaacgactgtgttatgt
gaagggatattgacgtttcaacgcgaaacgtttcatgtgagtggatatgaaattcatatg
ggacgctcgatcgtaaaaagcggtgagccgcttatttcgcagaatgggaaaacagatggt
tgtaaaacgaaagatgaacgcgtgattggaacatatatgcacgatttatttcataacgat
gcgtttcgccatcatttattaaacgacgtgcggagaaaaaaacaactgctgccactttct
acaagaccgctttatcgacaattgcgcatgcaagcatttgatgaactagccaattgcgtc
gaaacaagcgtcaatgtgacaacaattgaacgaaaaatgatggaatttcaagggggagat
catcatgctttatga

DBGET integrated database retrieval system