KEGG   Anoxybacillus gonensis: AFK25_05000Help
Entry
AFK25_05000       CDS       T04000                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00020  Citrate cycle (TCA cycle)
agn00620  Pyruvate metabolism
agn01100  Metabolic pathways
agn01120  Microbial metabolism in diverse environments
agn01200  Carbon metabolism
agn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:agn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFK25_05000
   00620 Pyruvate metabolism
    AFK25_05000
Enzymes [BR:agn01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AFK25_05000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA CPSase_L_D2 Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 ATP-grasp Dala_Dala_lig_C ATP-grasp_3 HlyD_D23 RnfC_N HlyD_3 GCV_H ATP-grasp_4 RimK ATPgrasp_Ter YqfD NQRA Amidase_3
Motif
Other DBs
NCBI-ProteinID: AKS37911
UniProt: A0A0A2SWA8
Position
928452..931898
Genome map
AA seq 1148 aa AA seqDB search
MHMRRIQKVLVANRGEIAIRVFRACNELGIRTVAIYSREDAGSYHRYKADEAYLVGEGKK
PIEAYLDIEGIIEIAKMHDVDAIHPGYGFLSENIEFAKRCEEEGIIFIGPKQAHLDMFGD
KVKARHQAKQAGIPVIPGSDGPVQSLEDVVRFGETYGYPMIIKAALGGGGRGMRIVRSQA
EVKEAYERAKSEAKAAFGSDEVYVEKLIEKPKHIEVQILGDEYGNIVHLYDRDCSVQRRH
QKVVEVAPSVSLSKALREDICQAAVKLMKNVQYVNAGTVEFLVSGDAFYFIEVNPRIQVE
HTITEMITGIDIVQSQILIAEGHALHSEKVGIPKQEDIRVHGYAIQSRVTTEDPLNNFMP
DTGKIMAYRSGGGFGVRLDAGNSFQGAVITPYYDSLLVKVTTWALTFEQAAAKMLRNLRE
FRIRGIKTNIPFLENVVQHPKFLTGEYDTSFIDTTPELFVFPKRKDRGTKMLSYIGTVTV
NGFPGIGKKKKPVFDPPRIPKVNHIEPMPKGTKQILDERGADGLVQWIKEQNRVLLTDTT
FRDAHQSLLATRVRTNDLLRIAEPTARLWPQLFSMEMWGGATFDVAYRFLKEDPWDRLIQ
LREKIPNVLFQMLLRASNAVGYKNYPDNVIREFVAQSAEAGIDVFRIFDSLNWVKGMTVA
IDAVRQTGKVAEAAICYTGDIFDPTRTKYNLDYYKQLAKELEQAGAHILAIKDMAGLLKP
QAAYTFISALKEVVDIPIHLHTHDTSGNGIYTYAKAIEAGVDIVDVAVSSMAGLTSQPSA
NTLYYALEGTERAPEVDIASLEKLSRYWEDVRKYYVDFESGMNAPHTEVYMHEMPGGQYS
NLQQQAKAVGLGDRWDEVKEMYRRVNDLFGDIVKVTPSSKVVGDMALYMVQNNLTEQDIY
ERGETLDFPDSVVELFEGYLGQPHGGFPETLQRIILKGREPITVRPGELLEPVDFEKLRE
ELYHIVQREVTDYDVLAYALYPKVFVEYVRTVEQFGDVSVLDTPTFLYGMRLGEEIEIEI
EKGKTLIVKLVSIGQPQADGTRVVYFELNGQPREIVIKDESIKTTVVARVKADRNNPNHI
AATMPGTVVKVLVEKGEKVKKGDHLMITEAMKMETTVQAPFSGMVKDIYVKGGDAIQTGD
LLLELAEK
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atgcatatgaggcgtattcaaaaagtacttgtcgcaaaccgtggagaaattgcgattcgc
gtgtttcgcgcctgcaacgaactaggaattcgcaccgttgccatttattcgcgcgaagat
gcaggatcgtaccatcgttacaaagcggatgaagcgtatttagttggagaaggaaaaaaa
ccgattgaagcatacttagacattgaaggcattatcgaaatcgcgaaaatgcatgatgtc
gatgcgattcatccgggctatggctttttatcggaaaacatcgaatttgcgaaacgatgc
gaagaagaaggcatcattttcatcgggccgaaacaagcgcatttagatatgtttggcgat
aaagtaaaagcgcgccaccaagcgaaacaagcgggcattccggtcattccgggaagcgac
gggcctgtgcaaagcttggaggacgtcgtgcgcttcggcgagacatacggttatccgatg
atcattaaagcggcattaggcggcggtggacgcggaatgcgcatcgttcgttcgcaagcg
gaagtaaaagaagcgtatgagcgggcgaaatcggaagcgaaagcggcatttggcagcgat
gaagtgtatgtcgaaaaattaatcgaaaaaccaaaacatattgaagtgcaaattttaggt
gacgaatacggcaacatcgttcatttatatgaccgagactgctcggtgcaacgccgccat
caaaaagttgttgaagtggcgccaagcgtatcgctttcaaaagcgcttcgcgaagacatt
tgccaagcggcagtgaaactaatgaaaaacgtgcaatacgtgaacgcaggaacggttgag
tttctcgtttctggcgatgcgttttacttcattgaagtgaatccgcgcattcaagtcgaa
catacaattacagaaatgattacagggattgatatcgttcaatcgcaaattttaattgcg
gaaggacatgcgctacatagcgaaaaggtcggcattccgaaacaagaagacattcgcgtt
cacggatatgcgattcaatcgcgcgtgacgacagaagatccgttaaacaattttatgcca
gatacagggaaaattatggcgtatcgttcaggcggtggcttcggcgttcgtttagatgcc
ggaaatagctttcaaggcgccgtcattacgccgtattacgattcgttgttagtcaaagtg
acgacgtgggcattaacgtttgagcaagcggcggcgaaaatgttgcgcaacttgcgcgag
tttcgtattcgcggcattaaaacgaacattccgtttttagaaaatgtcgtgcaacatccg
aagtttttaacaggcgaatacgatacgtcgtttatcgatacgacgccagagctatttgtg
ttcccgaaacggaaagaccgcggaacaaaaatgttatcgtatatcggaacggttactgtc
aacggttttccaggcatcgggaaaaagaaaaagccggtatttgacccgccgcgcattccg
aaagtgaaccatattgaaccgatgccaaaagggacgaaacaaattttagatgaacgggga
gcagacgggctcgttcaatggatcaaagaacaaaaccgcgtgttgttgacagatacgacg
ttccgtgatgcccatcaatcgcttttagcgacgcgcgtgcgcacaaacgacttattgcgc
attgcggagccgaccgcgcgtttatggccgcaactattttcgatggaaatgtggggcgga
gcgacgtttgacgtagcctatcgcttcttaaaagaagatccgtgggatcgtttaattcaa
ttgcgcgaaaaaattccgaacgttttgtttcaaatgttgcttcgcgcatcgaatgcggtc
ggatataaaaactatccagataacgtcattcgggagtttgttgcgcaatcagccgaagcc
ggcattgacgtattccgcattttcgatagtttaaactgggtaaaaggaatgacggtcgcc
attgatgcggtacgtcaaacaggaaaagtggcggaagcggcgatttgttatacgggcgat
attttcgatccgacgcgcacaaaatacaatctcgattactataaacagttagcgaaagag
ctcgagcaagctggtgcgcacattttagcgatcaaagatatggcggggctattaaagcca
caagcggcttatacgtttatttctgcgttaaaagaagttgtcgacattccgattcatttg
catacgcacgatacgagcggaaacggcatttatacgtacgccaaagcgattgaagcagga
gtcgatattgttgacgtagcggtaagctcgatggctggtttaacgtcgcagccgagcgca
aacacgctttattatgctcttgaaggcacagaacgtgcgccggaagtcgatatcgcatcg
cttgagaaattgtcgcgttattgggaagatgtgcgcaaatattacgtcgactttgaaagc
ggcatgaatgcgccgcatacggaagtatatatgcacgaaatgccgggcggacaatatagc
aaccttcaacaacaagcgaaagcggtcggcttaggtgatcgttgggatgaagtaaaagaa
atgtatcgccgtgtcaacgacttatttggcgacattgttaaagtaacgccatcgtcgaaa
gtggtgggcgacatggcgctatatatggtccaaaacaatttaaccgaacaagacatttat
gagcgcggtgaaacgcttgatttcccagattccgtcgttgaactgtttgaaggttatctc
ggtcagccgcatggcggattcccagaaacgttgcagcgcatcattttaaaagggcgtgaa
ccgattaccgttcgtccaggtgagctgttagagccggtcgactttgagaagttgcgcgaa
gagttataccatatcgttcaacgtgaagtgactgactatgatgtgttagcttatgcgcta
tatccgaaagtgtttgtggaatacgtccgcacggtcgaacagttcggtgacgtatctgtg
cttgatacaccaacgtttttatacggcatgcgtctcggtgaagaaatcgaaattgaaatt
gaaaaaggaaaaacgttaatcgtcaagctcgtttcgatcggtcagccgcaagcggacgga
acaagagttgtatattttgagctaaacggtcaacctcgcgaaatcgtcattaaagacgaa
agcattaaaacaacggtcgttgcgcgtgtgaaagcggatcgcaacaatccgaaccatatt
gctgcgacgatgccgggaacagttgtcaaagtgcttgttgaaaaaggggaaaaagtgaaa
aaaggtgaccatttaatgattaccgaagcgatgaaaatggaaacgaccgtgcaagcaccg
ttttccggtatggtgaaagacatttacgtcaaaggtggcgacgccatccaaacaggcgac
ttattgcttgaattagcggaaaaataa

DBGET integrated database retrieval system