KEGG   Anoxybacillus gonensis: AFK25_14020Help
Entry
AFK25_14020       CDS       T04000                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
agn  Anoxybacillus gonensis
Pathway
agn00650  Butanoate metabolism
agn00900  Terpenoid backbone biosynthesis
agn01100  Metabolic pathways
agn01110  Biosynthesis of secondary metabolites
agn01120  Microbial metabolism in diverse environments
agn01130  Biosynthesis of antibiotics
agn01200  Carbon metabolism
agn01212  Fatty acid metabolism
agn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:agn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK25_14020
   00630 Glyoxylate and dicarboxylate metabolism
    AFK25_14020
   00640 Propanoate metabolism
    AFK25_14020
   00650 Butanoate metabolism
    AFK25_14020
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AFK25_14020
   00072 Synthesis and degradation of ketone bodies
    AFK25_14020
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFK25_14020
   00310 Lysine degradation
    AFK25_14020
   00380 Tryptophan metabolism
    AFK25_14020
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AFK25_14020
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AFK25_14020
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AFK25_14020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:agn04147]
    AFK25_14020
Enzymes [BR:agn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AFK25_14020
Exosome [BR:agn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFK25_14020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AKS39653
UniProt: A0A0A2SKQ6
Position
complement(2677314..2678495)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSGVRTPFGKFGGSLSALSAAQLGGIAIKEALVRAHVNAEHVDEVVFGTVLQGG
QGQLPSRQAAREAGIPWETKTETINKVCASGMRSVTLGDQIIRAGDADVIVAGGMESMSN
APYMLPKARWGLRMGDSTVKDLMVYDGLTCSFTGVHMGIYGSETAKELSITREEQDRWAY
RSHQLAIAAIESGKLAEEIVPVAIPQRKGEPITVAIDESPRKDTSLEKLAKLAPVFDPTG
TITAGNAPGVNDGACALVLMSEERAQKEGLTPLATIVAHAAIAVEAKDFPKTPGIVINEL
LRKTGKTVHDIDLFEINEAFAAVALASMKIADLPEEKVNVNGGAIALGHPIGASGARIII
TLIHELKRRGGGTGIAAICSGGGQGDAIMIEVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaacggtcattgttagcggggtacgtacgccatttgggaaatttggaggaagt
ttaagcgcattgagcgcagcacaacttggaggcattgcgatcaaagaagcgttagtgcgc
gcacatgtgaatgcagaacatgtcgatgaagtcgtatttggcaccgtattgcaaggtgga
caagggcaacttccatcgcggcaagcggctagagaagcaggcattccatgggagacgaaa
acagaaacaatcaataaagtatgcgcctctggtatgcgcagcgtcacgcttggcgatcaa
atcattcgcgcaggggatgcggacgtcatcgtggcaggtggaatggagtcgatgagcaat
gccccgtatatgttgccgaaagcgcgttgggggttgcgcatgggcgattcgacagtaaaa
gatttaatggtgtatgacggattaacatgcagcttcacaggtgtgcatatgggcatttat
ggaagtgaaacagcgaaagaattaagtattacgcgtgaggagcaagaccgttgggcgtat
cgtagccatcaattagcgattgcggcgatcgaaagtggaaagctagcagaagaaatcgtc
cctgttgccattccgcaacgaaaaggagagccgatcacggtagcgattgatgaatcacca
cgaaaagatacatcgcttgaaaaattagcaaaactggcgcccgtgtttgatccaacaggc
acgattacggcaggaaatgcgccaggcgtaaatgacggagcttgcgcgcttgtattaatg
agcgaagagcgcgcgcaaaaagaagggcttactccgcttgcgacgattgttgctcatgcg
gccattgcggtagaagcgaaagattttccgaaaacaccaggcatcgtcatcaatgaattg
ttgcgcaaaacaggaaaaaccgtacatgacattgatttattcgaaattaacgaagcgttt
gcagccgtcgctttagcaagcatgaaaattgctgatttgccagaagaaaaagtgaacgtc
aacggtggcgccattgcgctcgggcatccgatcggtgcaagcggtgcgcgcattattatt
acgttaattcatgaattaaaacgccgtggtggcggcacgggtattgcagccatttgtagc
ggcggcggtcaaggcgacgcaatcatgattgaagttcattaa

DBGET integrated database retrieval system