KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AAL133WHelp
Entry
AGOS_AAL133W      CDS       T00167                                 

Definition
(RefSeq) AAL133Wp
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00450  Selenocompound metabolism
ago00970  Aminoacyl-tRNA biosynthesis
ago01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ago00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AGOS_AAL133W
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AGOS_AAL133W
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ago01007]
    AGOS_AAL133W
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ago03016]
    AGOS_AAL133W
Enzymes [BR:ago01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AGOS_AAL133W
Amino acid related enzymes [BR:ago01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AGOS_AAL133W
Transfer RNA biogenesis [BR:ago03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AGOS_AAL133W
 Prokaryotic type
   Other AARSs
    AGOS_AAL133W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 4618649
NCBI-ProteinID: NP_982409
UniProt: Q75F61
Position
I:113952..115655
Genome map
AA seq 567 aa AA seqDB search
MVASTRRALRAIQKFHITTPIFYPNAKPHLGHLYSSLICDVQARWQKLRDSEVLFTTGTD
EHGLKIQTASEQQGYASPKVFVDKLCTHFISLDEQANIGYTRFIRTTDKDHISNVLRLWE
LCKANGYIYKGEHSGWYSVSDETFYPATKVVQVIDGREFPVMDGSTVTEGAEYINTETRN
RVIHQTEVNYFFRLSSFRERLISHLKENPGFILPPSRSAQILDLLLKAELPDLSISRPKT
RLKWGISVPGDESQKIYVWFDALCNYVTSIGGVDAVLEDRPIANLVHSIPQGSVSGSSKE
WWNATTHLVGKDIVKFHTIYWPAILLAAGLPLPEKVVVHGHWLSDGVKMSKSLGNVVVPE
EMIEKYDTDPMRWFILEHDTIEHDASFSEEGLCQTRELLCSKWGNLLHRCGGPKFNIHRA
VQKFHHKPITDLTKNNPELYGNLLSRLTTLADEIDQLLSKYDTANALRLIWSIINDANMV
VQHGEPWKKPLEEQDLIIYTAVEAARIVSIAAQPFIPVLANRFLDRLDVHFDKRSLEYAS
VGADSSYGTTANVRGREVPISSLSRQR
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcaagtacccgtcgggcgctgcgagccattcaaaaattccatattaccactccg
atcttctatccgaatgcaaaaccgcatttggggcacttatactcttcattaatatgtgat
gtgcaagctagatggcaaaaacttagggattctgaagtgctattcaccactggaaccgat
gagcacggtctgaagatacaaacagcaagtgaacagcaaggctacgctagtcctaaggtg
tttgtagataaattatgcacccattttatcagcttagatgaacaggctaacattgggtac
actaggtttataagaacaacagataaggatcatatctcgaacgttttaaggctatgggag
ctttgcaaagcgaatggctacatatacaagggtgagcatagcggctggtactccgtgtcg
gatgaaacgttctatcccgctaccaaagttgtccaggtgatcgacggccgcgaatttccg
gtgatggatggttccaccgttactgaaggtgccgagtacatcaatactgagactcgcaac
cgtgtgatccaccagacggaagtgaattactttttcagactatcttctttcagagagcgg
ttaatcagtcatttgaaggaaaacccaggttttatcctcccgccatcccggtcagcgcag
attttagatctactactaaaggcagaactacccgacctttcaatctctaggcctaaaaca
cgacttaagtggggcatttctgttccgggcgatgagagccagaaaatatacgtctggttt
gatgcgttatgcaattacgtaacctcgattggtggggtagatgctgtcttagaggatagg
cccattgctaacctagtccactctattccacagggctcggtttcaggctcatctaaagaa
tggtggaatgctactactcatctcgtcggtaaggacatcgtgaaattccataccatatat
tggcctgcaattttacttgctgccggattaccgctacctgaaaaggttgtggtacacgga
cattggctttcagatggtgtgaaaatgtccaaaagcttggggaatgttgtggtacctgaa
gagatgatagagaagtatgatacagatccaatgagatggtttatcttggagcacgacact
atagaacatgatgcttccttttctgaagaaggtctttgccaaacgcgggaattgctgtgc
tcgaagtggggaaacctcctgcatagatgtggtggcccgaagtttaacatccaccgcgct
gtgcaaaagttccatcataaaccgatcacagatttgacgaaaaataatcctgagctatac
ggtaatttattgtccagattaacaaccttggcagatgaaattgatcagctattatcaaag
tatgatacggcaaatgctctgaggctgatctggtctatcataaacgacgcaaacatggta
gttcaacatggggaaccttggaaaaaaccacttgaggaacaagatctcatcatctatact
gcagttgaagctgcacgtattgtttctatagcagcacagcccttcattcctgtgcttgcc
aatcgcttcctggataggcttgacgttcatttcgacaagcgctccttagaatatgcaagt
gtgggcgcagattcatcttatggcactactgcaaacgtacgtgggagagaggtcccaata
tcgtctttatcgaggcaacgttag

DBGET integrated database retrieval system