KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AAR084WHelp
Entry
AGOS_AAR084W      CDS       T00167                                 

Definition
(RefSeq) AAR084Wp
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00010  Glycolysis / Gluconeogenesis
ago00071  Fatty acid degradation
ago00350  Tyrosine metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGOS_AAR084W
  Lipid metabolism
   00071 Fatty acid degradation
    AGOS_AAR084W
  Amino acid metabolism
   00350 Tyrosine metabolism
    AGOS_AAR084W
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AGOS_AAR084W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 4618556
NCBI-ProteinID: NP_982625
UniProt: Q75EJ5
Position
I:494098..495153
Genome map
AA seq 351 aa AA seqDB search
MSSPSIPKTQHAIVFDKNGGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPL
PTKLPLVGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNCPDADL
SGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVYKALKSANLRAGNWVAIS
GACGGLGSLAIQYARAMGYRVLGIDGGDEKEALFRKLGGEVFVDFRKSKDVVADVVKATG
GGAHGVINVSVSEAAIESSTEYVRSNGTVVLVGLPGGAKCKSDVFNHVVKSVSIVGSYVG
NRADTREALDFFARGLVQCPIKVVGLSELPDIYGKMERGEVAGRYVVDTSK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctccctctatccccaagacgcagcacgctatcgtcttcgacaaaaacggcggg
cccctcgagtaccgcgagatcgaggtgcccgagcccaagcccacggagctgctgatcaac
gtcaagtactccggcgtgtgccacacggacctgcacgcgtggaagggcgactggccgctg
cccacgaaactgccgctcgtcggcgggcacgagggcgcaggcgtcgtcgttgcgatgggc
gagaacgtgcgcggctggcaggtcggcgacctcgccggcatcaagtggctcaacggctcg
tgcatgtcgtgcgaggcgtgtgagcagggccacgagtccaactgccctgacgcggacctg
tccggctacacgcacgacgggtcgttccagcagtacgccacggcggacgcggtgcaggcc
gcgcacatcccggccggcaccgatctggcgcaggtcgcgccgatcctgtgcgcggggatc
accgtgtacaaggcgctcaagtccgcgaacctgcgtgcgggcaactgggtcgcgatctcc
ggcgcgtgcggcggcctgggctcgctggccatccagtacgcgcgcgccatgggctaccgc
gtgctcgggatcgacggcggcgacgagaaggaggcgctgttccgcaagctgggcggcgag
gtcttcgtcgacttccgcaagtccaaggacgtcgtcgccgacgtcgtcaaggcgaccggc
ggcggcgcgcacggcgtgatcaacgtctccgtgtcggaggccgcgatcgagagctcgacc
gagtacgtgcgctcgaacggcaccgtcgtgctggtcggcctgcccggcggggccaagtgc
aagtccgacgtcttcaatcacgtggtcaagtcggtgtccatcgtgggctcctacgtcggc
aaccgcgcggacacgcgcgaggcgctggacttcttcgcgcgcggcctggtgcagtgcccg
atcaaggttgtgggcctgtccgagctgcccgacatctacggcaagatggagcggggcgag
gtcgcggggcggtatgtggtggacacgtctaagtag

DBGET integrated database retrieval system