KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AAR170WHelp
Entry
AGOS_AAR170W      CDS       T00167                                 

Definition
(RefSeq) AAR170Wp
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00670  One carbon pool by folate
ago01100  Metabolic pathways
ago01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ago00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AGOS_AAR170W
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     AGOS_AAR170W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 4618749
NCBI-ProteinID: NP_982713
UniProt: Q75EA7
Position
I:647750..649561
Genome map
AA seq 603 aa AA seqDB search
MRISQKLKQRAGAADEEQPKASFSFEFFVPKTLQGVQNLYDRMDRMYQTQPEFIDITWNA
GGRLSQRTSELVATSQGVLGLETCMHLTCTNMSTALVDEALERAYEAGCENILALRGDPP
LQGTWEPCAGGFRYAKDLVAHIRARYGDHFDVGVAGYPEGHEEASGAELIGYLKEKVDAG
ADFIITQMFYDADLFLKWCDAVRAAGISVPIIPGIMPITSYAALLRRAKWCQVRLPPEFL
ERLEPVKDDDQAVREIGTVLVADMCRKILASGHVTHLHLYTMNLERASLMILERLQLIDT
GGAGVRRRPSTNETLPWRKSLNPTRRKEGVRPIFWQRRPYSYVARTSQWSADEFPNGRFG
DSSSPAYGDLDLCGHTVLRQTYQRSLELWSTPRTLLDLAALVISYLKGDLKCLPWSDVPL
HQEADALLDSLIRLNEHLVLTINSQPKVNGAPSADPIVGWGPANGYVYQKQYLEFLLPKH
HLPAFHAALTADFPTLTYFAVDADDNLASNHPDDTQANAVTWGIFPGREVLQPTIVEKAS
FLAWKDEFYRILDDWRLSFDENGAADSAALLAHLTSDYALVNIVDNDFVATADNIYCLLA
RFF
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaggatctcgcagaagctcaagcagcgcgcgggggcggcggatgaggagcagcccaag
gcaagcttctcctttgagttcttcgtgccaaagacattacagggagtgcagaatctctac
gaccgcatggaccgtatgtaccagacccagccggagttcatcgacatcacatggaacgca
ggggggcggctatcgcagcgcacgtcagagctggtggcgacgtcgcagggcgtgctggga
ctagaaacttgcatgcacctgacgtgcacgaacatgtctaccgcactggtagacgaggcg
ctggagcgggcgtacgaggcgggatgcgaaaacatcctggcgctgcgcggggacccgccg
ttgcagggtacatgggagccgtgcgcgggagggttccggtacgccaaggacctcgtggcg
cacatccgcgcgcgctacggcgaccacttcgacgtcggtgtggctgggtacccggaggga
cacgaggaggcgagcggggccgagttaatcggctacctcaaggagaaggtggacgcgggc
gcggacttcatcatcacccagatgttctacgatgcagatctgttcctgaagtggtgtgac
gcggtgcgcgcagctggcatctccgtgccgatcatccctgggatcatgcccattacctcg
tacgcggcgctgctgcgccgcgccaaatggtgccaggtgcgcctgccgccggagttcctg
gagcggctggagcccgtgaaggacgacgatcaggccgtgcgggaaatcggcactgtgctc
gttgcagacatgtgccgcaagatactggcgtccgggcatgtgacgcacctgcatctctac
acgatgaacctcgaaagggcatcgctgatgatcctggagcgcctgcaactcatagatact
ggcggagcgggtgtgcgccgcaggccaagcacgaatgagacgctgccgtggcgcaagtcg
ctcaacccgacgcgccgcaaggagggcgtgcgccccatcttctggcagcggcggccctac
tcatacgtcgcgcgcacgtcgcagtggagcgcggacgagttcccgaacgggcgtttcggc
gactcctcgtcccccgcctacggcgatctcgacctctgcgggcacacagtgctgcggcaa
acataccagcgctcgctcgagctgtggtccacgccccgcacgcttctcgacctcgcggcg
ctggtcatcagctacctcaagggcgacctcaagtgcctgccgtggtccgacgttcccctg
caccaggaggcggacgcattgctcgacagcctcatccgcctcaacgagcacctcgtgctg
accattaactcccagcccaaggttaatggcgcgccctccgccgacccgatcgtcggctgg
ggccccgccaacggctacgtttaccagaaacagtacctcgagttcctgctgcctaagcac
cacctgcccgccttccacgccgccctcaccgcggacttccccacgctcacctacttcgcc
gtcgacgcagacgacaacctcgcctccaaccaccccgacgacacccaggccaacgccgtc
acatggggcatcttccccggccgcgaggtcctccagcccaccatcgtcgaaaaggcctcc
ttcctcgcctggaaggacgagttctaccgcatcctcgacgactggcgcctcagcttcgac
gagaacggcgctgcagactccgccgccctgctggctcacctcacctccgattacgccctc
gtcaacatagtcgacaacgacttcgtggccacagctgacaacatatactgcctgctcgcc
cgtttcttctag

DBGET integrated database retrieval system