KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ABL056CHelp
Entry
AGOS_ABL056C      CDS       T00167                                 

Definition
(RefSeq) ABL056Cp
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00010  Glycolysis / Gluconeogenesis
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGOS_ABL056C
Enzymes [BR:ago01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AGOS_ABL056C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 4618974
NCBI-ProteinID: NP_982891
UniProt: Q75DT2
Position
II:complement(294406..295296)
Genome map
AA seq 296 aa AA seqDB search
MSVDADEKEVILVHPSNEKTAVKILNYGATIYSWTIDGEEQLWLSDAAKLDGSKPVRGGI
PLVFPVFGKNTDDEHFSKLPQHGLARNSTWEFLGQTKENPPAVQFGLGPELANEELTALW
PFDYTLVLTVELGEEHLKTEIEVVNTSTSQTLRFNWLFHTYLKIDDVEDTMVSNLKNFKT
YDQLLKTSYVDRQPVVAFHEEVDRIYQQVADDRVIQIVDKGRPIHSVSRGNLPDVVVWNP
WIEKSANMQDFQPKEGYQKMICIEPGHVHDFVTLQPGEKWSGYQLLSKDTLKYQAV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagacgctgacgagaaagaggtgatcttggtccatccttccaacgagaagacg
gccgttaaaatcttgaattatggagcaacgatctattcctggacaatagacggcgaagag
cagctatggctatcggacgcggccaagttagatgggtctaaacccgtgcgcggaggcatc
ccattggtttttcctgtttttgggaagaacaccgacgatgagcacttttcaaagctgccg
cagcatggccttgcccgtaactctacgtgggaattcttgggtcaaaccaaggaaaaccct
ccagccgtgcaattcggcctggggccagagcttgcaaatgaggaactcaccgcactatgg
ccgtttgactacacactggtgcttaccgtggaacttggggaagaacatcttaaaacggag
attgaggttgtgaacacctccacatcgcagaccctccgtttcaattggttattccacaca
tatctgaagattgacgatgtcgaggacactatggtatccaacctcaagaactttaagacc
tacgaccagcttctgaagactagctacgtggacaggcaaccggtggtagccttccacgaa
gaggtggacaggatctaccagcaggtcgccgatgacagagttatacagattgtggacaag
ggacgtccaatccacagtgttagcaggggcaatcttccagatgtcgtggtctggaacccc
tggattgaaaaatcagcaaacatgcaggacttccagccaaaggaagggtaccagaagatg
atatgtatcgaacccggccacgttcacgacttcgtgaccctgcagccaggcgagaaatgg
tccgggtaccaactgttgtcgaaagacacgttgaagtaccaggccgtctga

DBGET integrated database retrieval system