KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ABR043WHelp
Entry
AGOS_ABR043W      CDS       T00167                                 

Definition
(RefSeq) ABR043Wp
  KO
K20989  urea-proton symporter
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ago02000]
    AGOS_ABR043W
Transporters [BR:ago02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   AGOS_ABR043W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 4619086
NCBI-ProteinID: NP_982989
UniProt: Q75DI2
Position
II:474251..476311
Genome map
AA seq 686 aa AA seqDB search
MDHLNPPLSQGVGYAIVVGLGAVFAIGMVMTTYILRRYQREVITAEEFATAGRTVKTGLI
ASAVVSSWTWAATLLQSTTMAYKVGVSGPFYYAAGACVQIILFSTLAIKCKQRAPNAHTF
LEIIKARYGRKAHILHMCYALVTNVLVTTMLLTGGSAVVSELTGMHTAAACFLLPVGVII
YTLFGGIKATFLTDYVHTVIIVGIILTFTFSVYRTSDMLGSASKVYDLLREAARQHPVKG
NRNGEYLTMKSESGGIFFVVSLVGNFGTVLLDNGYFTKAFSSSPAAALPGYVVGGIVWFA
IPCLVATSLGLACLALELLPSFPNYPSRLSQEQVDAGLVLPVAAFNLLGKGGAMAALLMV
FMAVTSAMSAELIAVSTIFTYDIYRGYVNPDAPGKRLIVTSHAACVVFGVAMSAVSVGLY
YAGISLGYLYEVMGIIISSAVIPSALTLFWSKQNIYAVTIAPLVGTTLAVTSWLVCAKVL
YGSITVENTYKDYPMLTGNLVALLSPALLIPLLTYSLGADSYDWIAMKTDILRVDETDEL
LDADKGLAMVVTRELFESSSVPSAIEKEEINHTTEPNLQREMTNGLEEERILKRASRLAT
ILCAIFILSFLVLWPVPMYGTGYIFSKGFFTGWVSVLTLWLFCTGFAVCIYPLWEGRHGL
FTTVRGIYWDCTGQKAKLRDWQCSQI
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggatcatctaaatccgcctctatcacaaggtgttggctatgccattgtggtgggcctt
ggagctgtctttgcgattggaatggtgatgactacctatatcttgaggaggtaccagagg
gaagtcatcactgcggaagaatttgctacggcaggaagaacagtaaagacagggctcatt
gcgtcggcagttgtgagcagttggacatgggcagccacgctactgcagtcaactaccatg
gcatacaaggtaggggtcagcgggccgttttattacgctgctggcgcatgcgtacagatc
attttgttctccacgcttgcaatcaaatgtaagcagcgggcaccgaatgcacacacattc
ctggagattatcaaggcacggtacggacgtaaggcacacatattgcacatgtgctatgca
ttggtgacaaacgttttagtcacaactatgctcttaaccggagggtccgcggtggtctcc
gagctgactggtatgcatacagccgcagcgtgtttcctactgccagttggggtgataatc
tacactttgtttggcgggataaaagcaactttcctcactgattatgtgcacactgtgatc
attgtcggcatcatcctgacgttcactttttcggtgtatcgcaccagtgacatgcttggc
tcggcgtcaaaagtctacgatttacttcgggaggcggcaagacagcatcctgtaaagggc
aaccggaatggcgagtacttgacaatgaagtctgagtctgggggcattttctttgttgtc
tcacttgtcggtaactttgggactgttcttctggataacgggtatttcaccaaggccttc
tcatcttcgccagctgcggcactgccggggtatgtagttgggggtatcgtatggttcgca
ataccctgcctcgtcgctacatcgctagggcttgcttgcctggcgttggagcttctgcca
tccttccccaattacccatcacggctttcacaagagcaagtggatgccgggcttgttctc
ccagtcgcagcattcaacttgctaggcaagggcggcgctatggctgcgctgctaatggta
tttatggcagttacgtctgctatgtctgcagagctgattgcagtctcgaccattttcacc
tatgatatctaccgcggatatgtgaatcctgacgccccaggcaaaagactaattgtgacc
tcgcatgctgcctgtgtggtgttcggagtcgcgatgagtgcggtctcagtgggtctatac
tatgccggcatatccttgggatatctatatgaagtcatgggtatcatcatatcatccgcc
gttataccatcagctctaactttattctggtccaagcaaaatatttacgctgtaaccatc
gcaccacttgtgggtacaacgttagctgtaacctcatggcttgtgtgcgccaaggtgctg
tacggcagtatcacggttgaaaatacctacaaggactatcctatgctgacaggaaacctt
gtggcattactgtcgccagcgttgttgattccattgttaacatattcacttggcgcggat
agttacgattggatcgctatgaagacagatatattgcgagttgatgagacggatgagctg
ctggatgccgacaaggggctagccatggttgtcaccagggaattgtttgagtcgtctagc
gtacccagtgccatagagaaagaagaaatcaaccatactacggagccaaatctgcagcgt
gaaatgactaatggactggaggaagagcgcattttgaaaagggcgtcaagactggccact
attctgtgtgcgattttcatcctctcgtttttggtcctgtggccagtgcccatgtatggt
actgggtatatattctcaaagggcttcttcaccgggtgggtgtcagttttgaccttgtgg
ctgttttgtacaggctttgccgtctgcatatacccgctttgggagggccggcacggctta
tttactaccgtccgtggtatttattgggactgtacgggccaaaaagccaaactgcgggac
tggcaatgctcccaaatataa

DBGET integrated database retrieval system