KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ABR222W
Entry
AGOS_ABR222W      CDS       T00167                                 

Definition
(RefSeq) ABR222Wp
  KO
K10355  actin, other eukaryote
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ago04812]
    AGOS_ABR222W
Cytoskeleton proteins [BR:ago04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     AGOS_ABR222W
SSDB
Motif
Pfam: Actin GerD
Other DBs
NCBI-GeneID: 4619281
NCBI-ProteinID: NP_983171
UniProt: Q75D00
Position
II:join(818971..818980,819284..820404)
AA seq 376 aa
MDSGEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ
SKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKM
TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRID
LAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKS
YELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVM
SGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISK
QEYDESGPSIVHHKCF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggattctggagaagttgcagcattagtgatcgacaacggttcggggatgtgcaaggcc
ggtttcgccggtgacgacgctccccgggctgtgttcccttcgatcgtcggcagacccaga
caccagggtatcatggtgggtatgggccagaaggactcctatgtgggcgatgaggcgcaa
tcgaagagaggtatcttgacgttgcgttacccaatcgagcacggtatcgtcacaaactgg
gatgacatggagaagatctggcaccacaccttttacaacgaattgagagtggccccagag
gaacacccagtgttgttgacggaggcgcctatgaaccctaagtcgaacagagaaaagatg
acgcagatcatgtttgaaactttcaacgtgcctgccttctacgtgtccattcaggccgtc
ttgtcgctatactcttctggtagaacgacgggtattgtgttggactccggtgacggtgtt
acccacgttgttcctatctacgctggtttctcgttgccacacgccattttgagaattgac
ttggccggcagagatatgaccgactacttgatgaagattctatcggaacgtggctactcc
ttttccaccactgcagagagagaaattgtccgtgacatcaaagagaagctatgttacgtc
gccttggacttcgaacaagagatgcagactgctgcccagtcttcggccatcgagaagtcc
tacgagctacctgacggtcaggtgatcactatcggtaacgaaagattcagagctccagaa
gctttgttccatccatctgtgttgggcttggaggctgccggtattgatcaaaccacctac
aactccatcatgaagtgtgacgtggacgtcagaaaggagctctacggtaacattgtgatg
tctggtggtactactatgttccctggtatcgccgagagaatgcagaaggagatcacggcc
ttggcgccatcctccatgaaggtgaagattatcgctccaccagagagaaagtactccgtc
tggatcggtggttctatcttggcctctctaaccaccttccagcagatgtggatctcgaag
caggaatacgatgagtctgggccatccatcgttcaccacaagtgtttctaa

DBGET integrated database retrieval system