KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACL068WHelp
Entry
AGOS_ACL068W      CDS       T00167                                 

Definition
(RefSeq) ACL068Wp
  KO
K03441  aquaglyceroporin related protein, other eukaryote
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ago02000]
    AGOS_ACL068W
Transporters [BR:ago02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    AGOS_ACL068W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 4619456
NCBI-ProteinID: NP_983336
UniProt: Q75CI7
Position
III:235420..236850
Genome map
AA seq 476 aa AA seqDB search
MSGKHKTEQGFAQDLEQQGPPHHGHRSEYVTGEFVESGAPFVMQEVVANSGAVVSNLRQQ
ELANARAKPHGEHVNERDYDDLMSASMVVKPKPLHQNPQTPTVLPSNYQPINAWSQFKAT
YLREFFAEFLGTMVLVFFGDSVVVQTRMSSTARVTAFLGQLESNGLSGSPVEYMRHLVTP
DVAGSSISVNLCWASGVVMGYYAAGGPAITGAHMNPAVTLANYCFRGLPAVKVLIYWAAQ
MLGGYMGGLTVFWYYARVIKTTFPDWKTNESVIGCFSTVPLPYLDSNRQFISEFVIGALL
IGLIFALTDPYTCLTTDFFPIMLFLLIFSLLACGSYQTGAILNPARDIGPRLAMWTVGFS
RKALWEDHHHYFWVALVGPCVGGLVGALIYDLLIFQGHESPVNQPAAHVLKRLKTRFTSF
GRKTASTGEYTFSDKELTDVSSNNASGKNINFRSVTRGESTNGVPTIYSQSNDPKK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaagcacaagacagagcagggcttcgctcaggaccttgagcagcaaggcccc
ccccaccacggccaccgctcggaatacgtgactggcgagttcgtcgagagtggtgcgcca
ttcgtgatgcaggaggtagttgcgaattcgggtgcggtggtctccaacctacgccagcag
gagttggcgaacgcgcgggccaagccgcacggcgaacacgtcaacgagcgggactacgac
gacctgatgtcggcctcgatggtggtcaagcctaagccactgcaccagaacccgcagacc
cccacggtccttccgtcgaactaccaaccgatcaacgcctggtcccagttcaaggcgacg
tatctgcgtgaattctttgcggagttcttgggaaccatggttttggtgtttttcggcgac
tcggtagtggtccagacccgtatgtcttccactgcccgtgtcacagcattcctcgggcag
cttgaatcgaacgggttaagtggcagcccagttgagtacatgcgccacttggtgacacct
gacgttgctggaagctcgatatctgtcaatctctgctgggcgtccggtgtcgttatgggt
tattacgcagctggtggcccagctattaccggtgctcacatgaaccccgcagtgacgcta
gccaactactgtttcagaggccttccagccgtgaaggttcttatctactgggcagctcag
atgctaggtggttacatgggtggcttgaccgttttctggtattacgcaagagtgattaaa
acaaccttccccgactggaaaaccaacgaaagtgtaatcggctgcttctctacggtccca
ttgccctacttggacagcaacaggcagttcatcagtgagtttgtcatcggtgctctcttg
atcggcctaatatttgctctgacggacccttacacatgtctgaccacggactttttcccg
attatgttgttcctcttgatcttctctctattagcctgtggctcttaccagactggtgct
attttgaaccctgcccgtgatatcggtcctcgcttggccatgtggactgtcggcttcagc
agaaaggcactatgggaggaccatcaccactacttttgggtggccctcgtcggcccatgc
gtcggtggcttagtgggcgccttgatctacgacttgctaatattccagggccacgaatcc
cctgtgaaccagcctgccgctcacgtactcaagagactcaagaccagattcacctcattc
ggcaggaagaccgcttccacaggcgagtacaccttctcggacaaggaactgactgatgtg
agcagcaacaatgcctcgggcaagaacatcaatttcagatcggtaactcgcggtgagtct
acgaacggcgttccgaccatctacagccaatcgaacgatcctaaaaagtaa

DBGET integrated database retrieval system