KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACL205C
Entry
AGOS_ACL205C      CDS       T00167                                 

Definition
(RefSeq) ACL205Cp
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
SSDB
Motif
Pfam: OPT
Other DBs
NCBI-GeneID: 4619316
NCBI-ProteinID: NP_983199
UniProt: Q75CX1
Position
III:complement(1205..3841)
AA seq 878 aa
MSKISEGVGDPPSYGSRSPSLSSHDKEKEKYNAGAEEQVTAEVLTDEQLVYLISRMGYDH
PRDLSDVPASVRYLESKLAELDIEKCLRIIDLSFEIHNEDFNLKTDDWNDLVRFSKRDFD
PEDPQHVFELKTVAGIFEYYSPYVEVRAVASPVDDPTIPVETFRAYFLATFWVVVGSALT
MFFSERQPSIALSISAVQMLVYPCGLLWARLMPCWGFNVYGRRIALNIDSPWTEKEQMFV
TLLYGITTGSFYANYNILTQHIHYRSPMPYAYQLLLSIPLQFLGFGLAGIMRKYVVYPAT
AMWPSIMTTIALNKAMMSDEHSGGFGRKKMFYLTFAIIFVYNWFPTYLFEALSTFNWITW
IKPDNFNLATVTGGINGVGLNPLSTLDWTNIGVGGFYLPFRVTLTMYMGGLLAALITLGV
YYMNYSECQFLPIFTQSLYNNKAKVYQVEEILTEDRLLDEQKFQKYGFPYYTAGNMVAYG
CFMCVYTALVVSSILQQGAFYMRVYKAWILDLWSLRTRSGLREAFSNEKHVLDEFHDPHC
RMMRKYKEVPEWWYMSIFVVSIVIGVIVVTTFKTNTPVWGLFLAVGLNFILLLPITLLQA
TRGVTIGLNLLLQMISGLALPGNPYALMFIKAFGYNIDGQTDNYLSNMKMAHYAKIPPIP
LFRGQLLMVLIQVFVNLGVINWQLHNVENYCDPKQRFKFTCPGVRTYFNASVMWGAIGPR
RIFEHVYPIMKWCWLIGACVGLFFGIWKRLSIMYDKIPYPRRFSPVIFIIGMLSFGPPYN
LQYSTSGLYVGFISMFYLKRYHLRIWERYNYVIAAAITCGVVFSAILMFFSVQWKDIELN
WWGNSISYAGLDYARVPLLNVTETERGYFGPELGHIPK
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgagcaagatctctgaaggtgtcggggaccccccttcgtatggtagccgctcaccaagc
ttatctagtcacgacaaggaaaaggaaaaatacaatgctggtgcagaagagcaagttacc
gcggaggttctcacagacgagcaattggtgtacctcatctctcgaatgggctacgaccac
cccagagatctcagcgatgtgcctgcttcagtaagatacctggagtcgaagcttgcggaa
ttggatatcgagaaatgcttgagaataatcgatctgagctttgagatacataatgaggac
ttcaatttaaagactgatgattggaatgatttagttcgtttctcgaagagagattttgac
cccgaagatccgcagcatgtgttcgaacttaaaactgttgcagggattttcgagtactac
tcgccgtacgtggaagtgagggcggtcgcgagccctgtggatgatccaacgattccagta
gagactttccgtgcctatttcttggcgactttttgggtggttgttgggagtgccttgacc
atgttcttttcggagagacagccttcaatcgctctcagtatatctgcggtgcagatgctg
gtgtatccctgtggactcctgtgggcgcgcttgatgccatgctggggcttcaacgtctat
ggccgcaggattgcactcaacatcgatagtccgtggaccgagaaggagcagatgtttgtg
acgctgttgtacggtatcactactggctcgttctacgcgaactataatattttaacgcag
cacattcactacagaagccctatgccatatgcgtatcaattgctactatcaattccactc
cagttcttggggtttggcttggctggaatcatgagaaaatacgtggtgtatccagcgact
gctatgtggccatccataatgactacgatagcgctgaataaggcgatgatgagcgacgag
cactcgggggggtttggtagaaaaaagatgttctacttgacttttgcaattattttcgta
tacaattggtttccgacataccttttcgaagccttgagtacttttaactggataacttgg
ataaaaccggataacttcaatcttgcgactgtcactggcggaattaatggcgtgggactg
aacccactttcgacgttggactggactaacattggagtgggcggtttttatcttccattc
agagtaacgctgactatgtatatgggaggtctacttgcagcactaatcactctcggcgtc
tattatatgaactacagtgaatgtcagtttcttccaattttcacgcaaagcttatataat
aacaaagcaaaagtgtaccaagtagaggaaatactgactgaagatcgattactcgatgag
cagaagttccagaaatacggatttccatattatactgcaggtaacatggtggcgtatggt
tgttttatgtgcgtttacacagcgcttgtggtgagctccatcctgcagcagggggcattt
tatatgcgggtgtataaagcctggatcctagatctatggtcactgagaacgcgtagcggg
ttgcgtgaagccttcagtaacgaaaagcacgtgttagacgaattccacgacccacactgt
cggatgatgaggaaatacaaagaagtacctgagtggtggtacatgtcaatatttgtggtt
tcaatcgtgattggagtcatcgtggtgacaacgttcaaaaccaatacacctgtgtgggga
ttatttctagccgtaggcttaaacttcattctgcttcttccaattacgttactacaagcc
acgcgcggtgttactataggactgaacctgttgctgcaaatgatcagtggcctggcattg
ccaggaaatccttatgcgctaatgtttatcaaggcattcgggtataatattgatggccaa
actgataactatctcagcaatatgaagatggcacactacgcgaaaataccacctatccca
ctatttaggggacagcttttaatggttctgatacaggtctttgtgaatcttggcgttata
aattggcagcttcataatgttgagaactattgcgatcctaagcagcggttcaagttcaca
tgtcccggcgtcagaacatacttcaatgcttctgtcatgtggggtgctattggaccaaga
cgaatctttgaacatgtctatcctatcatgaaatggtgctggttaattggggcgtgcgta
ggattattcttcggaatatggaagaggctcagtatcatgtacgacaaaataccgtaccct
agacgtttcagtccggtgatcttcattattggcatgctttcttttggtcctccctataat
ttgcagtatagtacctctggtctctatgtgggcttcatttctatgttttacttgaaaaga
taccaccttcgtatatgggagaggtataattatgtcattgctgccgccatcacctgcggg
gtggtgttttctgctatcttgatgtttttctccgttcaatggaaggacattgaacttaac
tggtggggaaacagtatctcatatgcgggtcttgattacgctcgggtgccgcttcttaat
gtgaccgaaactgagagaggatactttggaccagagcttggccacattccgaaatag

DBGET integrated database retrieval system