KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR054CHelp
Entry
AGOS_ACR054C      CDS       T00167                                 

Definition
(RefSeq) ACR054Cp
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AGOS_ACR054C
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AGOS_ACR054C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 4619582
NCBI-ProteinID: NP_983457
UniProt: Q75C62
Position
III:complement(454022..454942)
Genome map
AA seq 306 aa AA seqDB search
MLSRITRSSKALNFALGTTAVAAAGYLYAQSRGNLSTSLNKGDVTGQAAAQTFTGDGQWH
ALKIAKIEQVSHDTRRFTFALPSQDHVTGLTTASALLAKYVTPKGSNVIRPYTPVSDNMA
RGMFQLVIKHYDGGKFTTHLFGLKENDTVEFKGPIQKWRWDPNMFDSIVLMGAGTGITPL
FQMMHHIAENPTDNTKVHLLYGNKTPQDILLRKELEELASKYPDQVKVTYFVDKPEGDYK
GEKGFITKDFLKQNLPTPGSNSHIFVCGPPPFMDAFSGNKVSPSDQGQVTGVLSELGYTK
DHVYKF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccagaataacgagatccagcaaggcattaaactttgcgctcggtactaccgca
gtcgcagccgccggctacctgtacgcgcagtcgcgcgggaatctgagcaccagtctgaac
aaaggcgacgtgaccgggcaggcagcagcgcagacattcaccggggatggccaatggcac
gcactgaagattgccaagatcgagcaagtttcgcacgacacgcgccgtttcaccttcgcg
cttccttctcaggatcacgtgacaggtttgaccactgcgtcagcgctgctagccaagtat
gtgactccaaagggctccaacgtgatcagaccatacaccccagtcagtgacaacatggcg
cgcgggatgttccagctggtgatcaaacattacgacggcggcaagttcacgacccacctc
tttgggcttaaggaaaacgacactgtggagttcaagggacctatacagaagtggcgctgg
gaccccaacatgtttgactcgattgtgctcatgggtgccggtacgggtattacccctctg
ttccagatgatgcatcatatcgcggaaaacccaactgacaacaccaaggtgcatcttctg
tacggcaacaagaccccccaggacattctgctacgcaaggaactcgaggagctagcttcg
aagtaccctgaccaggtgaaggtaacgtatttcgtggacaaaccagagggtgactacaag
ggtgagaagggctttatcacgaaagacttcttgaagcagaacttgccaaccccgggctcc
aactcgcacatctttgtatgcgggcccccaccatttatggacgcgttttccggcaacaag
gtatccccatctgaccagggtcaggttacgggtgtcctatctgagctaggctacaccaag
gaccatgtttacaagttctaa

DBGET integrated database retrieval system