KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ACR056WHelp
Entry
AGOS_ACR056W      CDS       T00167                                 

Definition
(RefSeq) ACR056Wp
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00010  Glycolysis / Gluconeogenesis
ago00260  Glycine, serine and threonine metabolism
ago00680  Methane metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01130  Biosynthesis of antibiotics
ago01200  Carbon metabolism
ago01230  Biosynthesis of amino acids
Module
ago_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ago_M00002  Glycolysis, core module involving three-carbon compounds
ago_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGOS_ACR056W
  Energy metabolism
   00680 Methane metabolism
    AGOS_ACR056W
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AGOS_ACR056W
Enzymes [BR:ago01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AGOS_ACR056W
Membrane trafficking [BR:ago04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AGOS_ACR056W
Exosome [BR:ago04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AGOS_ACR056W
  Exosomal proteins of melanoma cells
   AGOS_ACR056W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 OprB
Motif
Other DBs
NCBI-GeneID: 4619584
NCBI-ProteinID: NP_983459
UniProt: Q75C60
Position
III:456517..457260
Genome map
AA seq 247 aa AA seqDB search
MPKLVLVRHGQSEWNEKNLFTGWVDVKLSAVGEQEAARAGELLKEHNVNPDILFTSKLTR
AIQTANIALTKADRIWIPVERSWRLNERHYGDLQGKDKAATLAAFGEEKFNTYRRSFDVP
PPPIADDSEFSQSNDERYRDVDPNVLPKTESLALVIDRLLPYWQDTISKELLSGKTVMIT
AHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPTKPSYYLDPEAAAAGAAA
VANQGKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagttagtcctagttagacacggtcaatccgaatggaacgagaagaacctattc
accggctgggtggacgttaagttgtccgctgtcggcgagcaagaggctgccagagctggt
gagctattgaaggagcacaatgtcaacccagacattcttttcacctcgaagttgaccaga
gccatccagaccgccaacattgcgttgaccaaggccgacagaatatggatcccagtcgag
cgttcgtggagactaaacgagagacactacggtgacctacagggcaaggacaaggctgcc
accttggccgcattcggcgaggagaagttcaacacgtacagaagatccttcgacgttcct
cctccacctattgcggacgactctgagttctcgcagagcaacgatgagagatacagagac
gtggacccaaacgtcttgcctaagactgagtctttggccttggtcatcgacagactgttg
ccttactggcaggacaccatctccaaggagttgttgagcggcaagactgttatgatcact
gcccacggtaactcgttgagaggtttggtcaagcacctagagggcatctctgacgccgac
atcgccaagctaaacatccctaccggtatcccattggtgttcgagctggatgagaacttg
aagccaaccaagccatcctactacttggacccagaggccgctgccgccggtgctgctgcc
gttgccaaccaaggtaagaaatag

DBGET integrated database retrieval system