KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL155CHelp
Entry
AGOS_ADL155C      CDS       T00167                                 

Definition
(RefSeq) ADL155Cp
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Myc_target_1 DUF2606
Motif
Other DBs
NCBI-GeneID: 4620083
NCBI-ProteinID: NP_983941
UniProt: Q75AS5
Position
IV:complement(418828..420288)
Genome map
AA seq 486 aa AA seqDB search
MVVIDKDSVQVRHGDEPVALDVSPSSDSGRATAVGDKELFGDGPTTTCAQQTVPLSDEKV
EEEERAYLDNSNEYPDGGLRAWLVVFGSFMGLFPVWGMYNTLGAIEGYVSEHQLASNSTL
EISWIFSLHLTIGCLCCVFSGSYFDRNGGQKAIIVGGALYVFGIFMMSECTKVWQFVLSF
SVSSGIGAGIVTTPLVSCVATWFNRRRAVATSLATCGSSIGGIIMPLILRRMYVTIGFKW
AIKVLALVFLVNMSLAVLLARERVTPKAEPFKSFKEGAMFYTRTSLNWRYFLDARFLWCS
IAFALGENSICVTATYISSYINKQGHPASMPYTALTVLNAAALFGRYIPSYFADHHFGRF
NVQIVMALLAGVLHLAMWLPFGGNVHVLWAWVCTYGFMSGSVFSLSPVCISQICKTSDFG
KYYSTAYLLNALVTLPIMPVAGAVIGNGSIRGYNNFIIFTSMLILCACIGYVISRAYCVG
WRLCRF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcatcgacaaggacagcgttcaagtacggcatggcgatgagcccgtagcccta
gacgtcagcccatcgtctgacagcggcagagccacagctgtgggcgacaaagagcttttt
ggcgatggcccaacgaccacgtgcgctcagcagactgtccctctcagcgacgaaaaggta
gaggaagaagaacgcgcatatctcgataactccaacgaatacccggatggcggcttacgc
gcgtggctggtggttttcgggtcattcatgggtctgtttccggtgtggggtatgtacaac
acactgggcgccattgagggttatgtttccgagcaccaactggcaagcaacagtacccta
gaaatatcgtggatattctcgctccatttgaccattggctgcctctgctgcgttttcagc
ggaagttatttcgatcgtaacggcggacagaaagcgataattgtcggcggtgccttatac
gttttcggaatttttatgatgtccgaatgtaccaaggtatggcagttcgtcctgtcattc
tccgtatcaagtggcataggtgctggtatcgtaaccacgcctctagtatcatgtgtggct
acctggtttaacagacgccgcgccgtcgccaccagtctggccacgtgcggcagctccata
ggtggtatcatcatgccgctaattctacggcggatgtatgtcaccatcgggttcaagtgg
gcgataaaagtgctcgcgctcgtatttctggtgaacatgtcgctggcggtgcttctggcg
cgcgaacgcgtaactccgaaggcagagcccttcaagagcttcaaggaaggcgccatgttc
tacacaaggacatcactcaactggcgctacttcctagacgcgcgtttcctgtggtgctcg
atcgcgtttgcgcttggggagaactcgatctgcgtgacggccacgtatatctcgtcctac
attaacaagcagggccacccggcctcgatgccgtacacggcacttacggtgctgaacgct
gccgcgctgttcgggcgctacatcccgtcctactttgccgaccaccacttcgggcggttc
aacgtacagatcgtcatggcgctgcttgcaggggtgcttcatctggcaatgtggctgccc
tttggcggcaacgtccacgtgctgtgggcatgggtgtgcacctacggcttcatgtccggc
tccgtgttctcgctgtcgccggtgtgcatcagccagatctgcaagacgtctgacttcggc
aagtactactccaccgcctacctgctcaacgcactagtgaccctccccattatgcctgtg
gcgggcgcggtgatcggcaacggcagcatccgaggctacaacaactttattattttcacc
tccatgctgattctgtgtgcctgcatcggctatgtcatctcaagggcctactgcgtcggg
tggcgcctctgcaggttctag

DBGET integrated database retrieval system