KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL197CHelp
Entry
AGOS_ADL197C      CDS       T00167                                 

Definition
(RefSeq) ADL197Cp
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ago04131]
    AGOS_ADL197C
Enzymes [BR:ago01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     AGOS_ADL197C
Membrane trafficking [BR:ago04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    AGOS_ADL197C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 4620041
NCBI-ProteinID: NP_983899
UniProt: Q75AW7
Position
IV:complement(351433..352605)
Genome map
AA seq 390 aa AA seqDB search
MASLSPGMINFAMAVIFPAGMVVMSYMSSSNFLLFTIADLLALPLSSQQGTHRGSKAICQ
VSGYAMHICSLIPILFPKLLTCGLALYSAVVLWLKVSVIGSFIQGTVLLTLVPLILYAYF
STIAVGPGSPLDFEELRIRDLNDVETGMEFPPDFLAAKTVTLDSTGRHRYCVKCKVWKPD
RCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWICIITTWDLVVWF
RAHSYERELLNVHLVCLWALSAAATVALTAFCAFNIYLVCKNETTGEYQRRSTLNSDLEM
YADCTNGPRTVIENPFDLGSRRRNWAAVMGDTWKEWLLPIRTTASQKARHSFDESGLYFK
IDEQAHAKLAESMALQARLITRFNSKRAVQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggctagtctatccccgggaatgattaacttcgccatggctgttatatttcctgcagga
atggtggtgatgagctacatgtcaagttcaaattttttacttttcacgatagctgatttg
ctcgccctgcctttaagcagtcaacagggaactcatcgtggaagcaaagctatatgccaa
gtgtccggctacgccatgcacatatgtagtctgatacccatacttttcccgaagttgttg
acttgcgggttggcgctgtactcagctgttgttctttggctgaaggtttccgttatcggc
agtttcatccagggaacagtgctgcttacgctggtcccgctgattctgtatgcatatttc
tcgactatagcagttgggcctggtagcccgctggactttgaagagctacgcatccgagac
ctcaacgacgtggagactggaatggagttcccgccggactttttagcggccaagaccgtg
acgctggacagcacaggccggcaccgctactgcgtgaagtgcaaggtgtggaaaccggac
cgctgccaccactgctccgcgtgcgataagtgctacctgagacgcgaccaccactgcgta
tggtttccaggctgcattggctacaataaccacaagttttttctgcattttctgctgtat
gcgagcgtctatgctttttggatctgtatcatcacaacgtgggacctggtcgtttggttc
cgcgcccatagctatgagagggagctgttgaatgtacaccttgtgtgcttgtgggcgctg
tccgcggccgcgaccgtcgcgctcaccgccttttgcgcgttcaacatatacctggtgtgc
aagaacgagacaacgggcgaataccagcgccgcagtacgctgaacagtgacctagagatg
tatgcggactgtactaacgggccgcgtactgtcattgagaacccgttcgatcttggcagc
cgtcgcaggaactgggctgcggtgatgggtgacacttggaaggagtggttgctgccaata
cgcacaactgcttcgcagaaagccagacactcttttgatgagtccgggctatacttcaag
attgacgagcaagcgcatgcgaagctcgctgagagcatggcgcttcaagcaagactgata
actcgtttcaactccaagcgtgctgtgcagtaa

DBGET integrated database retrieval system