KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADR242CHelp
Entry
AGOS_ADR242C      CDS       T00167                                 

Definition
(RefSeq) ADR242Cp
  KO
K14848  ribosome assembly protein RRB1
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ago03009]
    AGOS_ADR242C
Ribosome biogenesis [BR:ago03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    AGOS_ADR242C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CAF1C_H4-bd WD40 ANAPC4_WD40 eIF2A
Motif
Other DBs
NCBI-GeneID: 4620500
NCBI-ProteinID: NP_984338
UniProt: Q759N3
Position
IV:complement(1126835..1128400)
Genome map
AA seq 521 aa AA seqDB search
MSKRSASIEELEDGQGRVVQSKTDLHTVPVAGGEDEDVDMHDEEMGEFEDPYGDDFDSEG
EIIQVDDDADGDDDAMDDEEYLEQKQQQAENMVENDKGADTKEGQLYLPHMSQPLGPDEV
LQADPTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSILMTTATQASKKKDNELLVL
KLSQLAKTLAKDEDDGAEDDEDDEDEDADPIIENENIKLRDTTNRMQVSPFAAESQEVLA
ATMSENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKTGA
LLTGDCSGRVFLTQRTSSKWITDKQPFTVDNNKSIEDIKWSPSENTVFATCGVDGHVRIW
DIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQGGVSPV
AQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAEVKELQQIP
PQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGLNVWKTISV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagagatcagcttcaatcgaagaactagaagatggacaggggcgggtagtccaa
tccaaaacagatcttcacacagtgcctgtggcaggcggagaggatgaagacgtcgatatg
cacgatgaagagatgggggaatttgaagatccgtatggcgacgacttcgacagcgagggc
gagatcattcaggtggatgatgatgccgacggagatgacgatgccatggacgacgaggag
tacctggagcagaagcaacagcaggccgagaacatggttgaaaatgacaaaggcgctgat
acaaaggaagggcagctgtacctgccacacatgtcgcagcccctaggacctgacgaggtg
ctgcaggcagatcctactgtttatgagatgcttcacaatgtcaatcttccatggccatgc
atgacgctggatctgatcccggataaccttgggtctgagcggagaaattacccacagtcg
attctgatgactacggccacgcaggcatccaagaagaaagacaacgagctgcttgtgcta
aagttatctcaattggcgaaaacccttgcgaaggatgaggacgacggtgcggaggacgac
gaagatgacgaggacgaggacgccgatccgattatcgagaacgaaaatatcaagctacgt
gacacaacgaaccgaatgcaggtatccccgttcgccgctgaatcacaggaagttttggcc
gctaccatgagcgaaaacggtgaggcacatatatttgaccttggacctcaagtaaaggca
ttcagctcgccaggttaccaggtccctaaagctgcgcaaagaccacagtacactatcaaa
aatcatgggaatgtcgagggctatggactagactggtcgcctttgatcaaaactggcgct
ctcttgaccggagactgctccggaagggtatttttgacccagagaacttcctccaaatgg
attaccgacaagcagccattcactgtcgacaataataagtccatcgaggacataaagtgg
tctccaagtgaaaataccgtatttgccacgtgcggtgtggacggccatgtccgcatatgg
gacatacggtctaaaaagcacaagccagcgctatctgttaaggtttcagacacagatgtg
aatgtcatgagctggaaccagaagatcagctacttgcttgctactggtgatgacaacggc
acatggggtgtgtgggacttgaggcaattctcgaaccagcagggaggtgtgtctccagtt
gcacagtacgatttccacaagggtgccattacctcgataagtttcaacccattggatgaa
tctatcattgcagttgcatctgaagacaacaccgtgaccctttgggacttgtctgtcgaa
gccgacgacgaagaaatcaagcagcaagcggcagaggtcaaggaacttcaacagattcca
cctcagctgctatttgtacactggcaaaaggaggtgaaggacgtgaaatggcataagcag
atccctggctgtctagtcagcacaggcaccgacggtttgaacgtttggaaaactatcagt
gtctga

DBGET integrated database retrieval system