KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER061CHelp
Entry
AGOS_AER061C      CDS       T00167                                 

Definition
(RefSeq) AER061Cp
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00020  Citrate cycle (TCA cycle)
ago00480  Glutathione metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01200  Carbon metabolism
ago01210  2-Oxocarboxylic acid metabolism
ago01230  Biosynthesis of amino acids
ago04146  Peroxisome
Module
ago_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ago_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ago00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGOS_AER061C
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AGOS_AER061C
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AGOS_AER061C
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AGOS_AER061C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 4621124
NCBI-ProteinID: NP_984921
UniProt: Q757F2
Position
V:complement(748897..750174)
Genome map
AA seq 425 aa AA seqDB search
MLGRGRMLGRRLFSGSRAAARIRVKTPVVELDGDEMTRIIWERIKQQLVLPHVDVELKYY
DLSITSRDATSDQVTVDAAHAIKQYGVGVKCATITPDEARVREFGLKKMWRSPNGTIRNI
LGGTVFREPIVIPRIPRLVPGWEKPIIIGRHAHGDQYKATDAVVPGAGTLDLVFRPADGS
APTSLHVYDFAGPGVALAMYNTEESIRGFAHASFRLALAKQLNLFLSTKNTILKQYDGRF
KDVFEELYQAQYKAEFERLGIYYEHRLIDDMVAQMVKSKGGFIMALKNYDGDVQSDIVAQ
GFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHFRQHQAGKETSTNSIASIFAWTRGLAKR
GELDNTPDVVNFAHALEAATTNTVQLDGIMTKDLALACGRSDRSAYVNTNEFIDAVEARL
KKELA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcagaggcaggatgctcggcagaaggttgttttcaggtagcagggcggcggcg
cggatccgggtgaagacgccggtggtggagttggacggggatgagatgacgcggatcatc
tgggagcgcatcaagcagcagctggtgctgccgcacgtggacgtggagctgaagtactac
gacctgtcgatcacgtcgcgggacgcgacgtcggaccaggtgacggtggacgcggcccac
gcgatcaagcagtacggggtgggcgtgaagtgcgcgacgatcacgcccgatgaggcgcgc
gtgcgggagttcgggctgaagaagatgtggcggtcgcccaacggcacgatccgcaacatt
ctgggcgggacggtgttccgcgagccgattgtgattccacggatccccaggctggtgccg
gggtgggaaaagccgatcatcatcggcaggcacgcgcacggggaccagtacaaggccacg
gacgcggtggtccctggcgcgggcacgctcgacctggtgttccggccggcggacggatct
gcacccacttcgctgcatgtgtacgacttcgcggggcctggcgttgccctggcgatgtac
aacaccgaggagtccatacgcggcttcgcgcacgcgtcgttccgcctggcgctggccaag
cagctgaacctgttcctgtcgacgaagaacacgatcctcaagcagtacgacggccgcttc
aaggacgtgttcgaggagctgtaccaggcgcagtacaaggccgagttcgagcgcctgggc
atctactacgagcaccgcctcatcgacgacatggttgcgcagatggtcaagtccaagggc
ggcttcatcatggcactcaagaactacgacggcgacgtccagtcggacatcgttgcgcag
ggcttcggctcgctcggcctgatgacctcggtcctggtgacgccggacggcaagaccttc
gagagcgaggctgcccacggcaccgtcacgcgccacttccgccagcaccaggcgggtaag
gagacgtccaccaactccatcgcgtccatctttgcctggacccgcggcctcgccaagcgc
ggggagctcgacaacacgccggacgtggtcaacttcgcccacgcgctcgaggcggccacc
acgaacacggtccagctcgacgggatcatgaccaaggacctcgcgctggcctgcggcagg
tcggaccgctcggcctacgtgaacacgaacgagttcatcgatgccgtcgaggcacggctc
aagaaggagcttgcttag

DBGET integrated database retrieval system