KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER118C
Entry
AGOS_AER118C      CDS       T00167                                 

Definition
(RefSeq) AER118Cp
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ago01009]
    AGOS_AER118C
Enzymes [BR:ago01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AGOS_AER118C
Protein phosphatases and associated proteins [BR:ago01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     AGOS_AER118C
SSDB
Motif
Pfam: Metallophos FANCI_S3
Other DBs
NCBI-GeneID: 4621184
NCBI-ProteinID: NP_984978
UniProt: Q756Z5
Position
V:complement(862755..864500)
AA seq 581 aa
MVRLSWSGDREQQSSSKQEMPSSDLLHEAHENTRKINAALNVIESKPQDGTGRKKSLSIY
TLEDGTKVSTKKRVVKSVPPVAKRLPTDEELFDADGLPNHEFLREHFRKEGRLSEEQAVR
ILEMATDILSREPNLLQVSAPITICGDLHGQYYDLLKLFEVGGDPKTTPYLFLGDYVDRG
SFSFECLLYLYSLKINYPDHFWMLRGNHECKHLTSYFTFKTECLHKYNLRIYDLCCHSFN
ALPLAAVMNGQYFCVHGGISPELKTVEDVNRINRFREIPSRGLMCDLLWADPSETYDEDA
DDPSTLAYTPNIIRGCSFAFSYKASCEFLQRTGLLSIIRAHEAQDQGYRMYKNTKNLGFP
SLLTLFSAPNYLDTYKNKAAVLKYSDNVMNIRQFNMSQHPYWLPNFMDVFTWSLPFVGEK
VTEMLVSILNICTEEELEEETFVIREDLGATLKSKNTEQVVTVIPGSKKSKKKRSILDDD
AKRRALRSKILAIAKVSRMYSVLREESDKVQYLKTMNSGVLPRGALSRGSEGLNEALSNF
ERARRADLENERLPPSLADVEKSREQYYRKKLEEFNEKEEK
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggttaggctatcttggagcggcgatcgggagcagcaatctagcagcaagcaggagatg
ccgtcatcagaccttctccatgaggcgcacgagaacacaaggaagataaatgcggccttg
aatgttatcgagtcaaagccacaagacggaaccgggcgcaagaagagcttgtccatctat
acactcgaggatgggaccaaggtatcgactaagaagcgggttgtgaagtcggtaccgcct
gtggcaaagaggttacccactgatgaggagttgtttgatgccgacggtttgccgaaccat
gagtttttgcgggaacacttccggaaagaaggccgcttaagtgaagaacaagcggtgcgg
attttagagatggccacagatattctctctcgcgagccgaacttgctacaggtgtcggcc
cccatcaccatatgcggcgaccttcacggacaatactacgatctgttgaagctatttgag
gtgggaggtgatcccaagacgacgccttatctctttttaggagactatgtggatcgtggc
tcgttttcctttgaatgtcttctctacttgtacagcttgaagatcaattatcctgaccat
ttttggatgctacggggaaaccacgaatgcaaacatttaacgtcgtacttcaccttcaaa
accgaatgtcttcataagtacaatctgcggatttacgacctgtgttgccactcatttaac
gcgttgcctttagctgctgtgatgaatgggcaatacttttgtgttcatgggggtatttct
cccgagctaaagacggtcgaggatgtcaacaggatcaacagattcagggaaatcccttcc
aggggcttgatgtgcgacttgttgtgggctgatccaagcgagacgtacgacgaggatgca
gacgatccaagtactctggcctatacgccgaatattatcagaggttgctcctttgcattt
tcttacaaggcatcttgtgagttcttgcagcgaactggccttctctcgataattagggcc
cacgaagcccaagatcagggctacagaatgtacaagaataccaagaatctgggctttcct
agtttacttacgttgttcagcgcacccaactacttggacacttacaagaacaaggccgcg
gtcctaaaatactcggataacgttatgaacattagacaatttaacatgtcacagcatccg
tattggttaccgaatttcatggacgtattcacctggtctttgccatttgttggcgagaaa
gtgactgaaatgttggtttcgatattaaacatttgtactgaagaagaattggaggaagag
acttttgttataagggaggacttaggtgctacattgaagtccaaaaacactgagcaggtt
gtaactgttatacctggctccaagaaatcgaagaaaaaacggtctattctggacgatgat
gcaaaacggcgtgcactacgcagtaaaatattggcgattgccaaggtttcccgaatgtat
agcgtgttgagagaagagagcgataaggtgcagtacctaaaaacaatgaattctggcgtg
ctgcctcgtggagcgctgtcacgcgggtctgaaggtctgaacgaggcgctgtctaacttc
gagcgcgctcgtagagcggatttggaaaacgaacgacttccaccatcattagcagatgtg
gagaagtctagagagcagtattacagaaagaagctcgaggagtttaatgaaaaggaagag
aaataa

DBGET integrated database retrieval system