KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER150WHelp
Entry
AGOS_AER150W      CDS       T00167                                 

Definition
(RefSeq) AER150Wp
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ago03009]
    AGOS_AER150W
Enzymes [BR:ago01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AGOS_AER150W
Ribosome biogenesis [BR:ago03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    AGOS_AER150W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C NPL Presenilin Coilin_N
Motif
Other DBs
NCBI-GeneID: 4621215
NCBI-ProteinID: NP_985009
UniProt: Q756V1
Position
V:919320..920573
Genome map
AA seq 417 aa AA seqDB search
MSELLPMATYNLNIEPYSPTPAIDVTVPVTVRLTMAAIDPESLDDEKKPATLRLIRRNPA
FDDEDDLLADSEEEEEEESEEESEPETKKPKKKAAKAESEEEDSEEEDSEGEDSDDEFEE
FVLATLSPESQYQQTLDLVISPEEEVQFVVTGSYRVSLSGNYVQHPYDDEDSYDEDHEGC
GENCACDDDHEGCGDDCACDDDSDYDLTPDEEDILDMEDASDVEAKIEELVEQEEANEKR
KADEDEPKAAKKQKKDQKDTKKDAKKDAKKDQKDQKDAKKDAKKEKKVEFKKDLEEGPSK
KKDDKPKTKILEGGVVIEDRVVGSGKAAKKGARVGMRYIGKLKNGKVFDKNTSGKPFVFK
LGHGEVIKGWDIGVAGMAVGGERRIVIPAAYAYGKQALPGIPANSELTFDVKLVSLK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaactattgcctatggccacctacaacttgaacattgagccctactcgcccacc
ccagccatagacgtcactgtcccagtgaccgtgcggctgactatggccgccatcgaccca
gagtccctggacgatgagaagaagccagcgaccttgcgtttgatccgcagaaacccagcg
ttcgacgacgaggacgatttgcttgccgactccgaggaggaggaggaggaggaatctgaa
gaggagtccgagcccgagaccaagaagcctaagaagaaggccgccaaggccgagagcgag
gaggaggacagcgaggaggaggacagcgagggcgaggacagcgacgacgagtttgaggag
tttgttcttgccaccctatctccagaatcgcagtaccagcagaccctagacctggtcatc
tccccagaggaggaggtgcagttcgtggtcacgggctcgtaccgcgtgtcgctgtccggt
aactacgtgcagcacccctacgacgacgaggactcctacgacgaggaccacgagggctgc
ggcgagaactgcgcctgcgacgacgaccacgagggctgcggcgacgactgcgcctgcgac
gacgacagcgactacgacttgaccccggacgaggaggacatcttggacatggaggacgcc
agcgacgtcgaggccaagatcgaggagctcgtcgagcaggaagaggccaacgagaagaga
aaggccgacgaggacgagcctaaggccgccaagaagcagaagaaggaccagaaggacacc
aagaaggacgctaagaaggacgccaagaaggaccagaaggaccagaaggacgccaagaag
gacgccaagaaggagaagaaggtcgagttcaagaaggacctggaggagggcccctccaag
aagaaggacgacaagcccaagaccaagatcctcgagggcggcgtcgtcatcgaggaccgt
gtcgtcggctccggcaaggccgccaagaagggcgcccgcgtcggcatgcgctacatcggc
aagctcaagaacggcaaggtcttcgacaagaacaccagtggcaagcccttcgtcttcaag
ctcggccacggcgaggtcatcaagggctgggacatcggtgtcgccggcatggccgtcggc
ggcgagcgccgcatcgtcatccccgccgcctacgcctacggcaagcaggcccttccaggc
atccctgccaactccgagttgaccttcgacgtcaagctcgtctctcttaaataa

DBGET integrated database retrieval system