KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER229CHelp
Entry
AGOS_AER229C      CDS       T00167                                 

Definition
(RefSeq) AER229Cp
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ago01002]
    AGOS_AER229C
Enzymes [BR:ago01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     AGOS_AER229C
Peptidases [BR:ago01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   AGOS_AER229C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 4621296
NCBI-ProteinID: NP_985086
UniProt: Q756M5
Position
V:complement(1059768..1061927)
Genome map
AA seq 719 aa AA seqDB search
MLQSIFKRVSIHSRNTFSILRTMATTNNQLSQLYLAERNAPVIMLSARKFFEQLTQKEKL
YAHYLVKAAHCGSRVVLRQVSHESESIFDMLLSIHKVMAGRYHESEENTLFLEYTSQFLS
NLGNFNSFGDTKFIPRCTQGHFFSLLKQAGLDKKAKPATNGCPFKTYKELVEIGVYAVDA
KSAMLGFPDLGHTTAYYFNCVSKADMQLLQKEVFAALDIMPENIRVKKGDDGNFVILVAS
AKKKVAENYPTGPVKLSNGRTVKFQFGDHNREMKMIAGYLKKAKEYAANDTQRKMMEEYI
KHFTTGDMKAHKESQKLWVKDLAPVVETDTGFIETYRDPAGIIGEYESLVAVRNKEQTKK
FAEMVAAAEKFLSLLPWGPEYEKPVFQAPDFTSLEVLAFTGSGIPSGINIPNYDDVRQNV
GFKNVSLGNVVSAPIKDQNPTFLSDTDGEIFNKYYIDAYEVQVGIHELLGHGSGKLLSEL
PDGSFNFDIKNPPLGVDGKPVSTYYAKGETWASKFGPLAGPFEECRAEVISMYLYTNREL
LSIFGFTTKEEQDKIIYTSYLVMIRSGLMALDFWDPATKNWGQAHMQARFSILKTFLEYS
PNKELLKLTYSQSDFDDLKIELRADLIETAGHESMKDYLRHLHIYKATGDFENGSKYFVD
RSTVTPELAKFRDVVRKKKLPRRQFIQANSVLNTKGQVLLREYKSNFEGMIESFVEREY
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgctacagtcgatatttaagcgagtatcgatacattcgcgtaatacatttagcattcta
agaacgatggctactacgaacaaccagctcagtcagttatacttggcggaacggaatgct
cccgttattatgctcagcgctcgaaaattctttgaacagctaactcagaaggagaaacta
tatgcccactacctcgttaaggcggcccattgcggctcgcgtgtggtattacgccaagtg
tctcacgaaagcgaatcgatctttgatatgttactaagtatccataaagtgatggccggg
cgctaccatgaatcagaagagaatactctcttcttagagtatacttctcaattccttagc
aacttggggaacttcaattcatttggtgacactaagtttattccgcgctgtacccaaggg
cacttcttttcccttttgaaacaagccggcctcgacaagaaagcgaagcctgccactaat
ggatgtccatttaaaacctataaagaattagtggagattggcgtctatgccgttgatgcc
aaatctgcaatgctaggtttcccggatcttggtcatacgacggcttattactttaactgc
gttagtaaagccgacatgcagttgttgcagaaggaagtctttgccgcactcgatattatg
ccagagaatatcagagtgaagaaaggcgatgatgggaactttgtaattctagttgcgtct
gcaaagaagaaggtcgcagagaactatcctacggggcctgtaaaattgtctaatggtcgc
actgtgaagtttcagtttggtgaccataaccgtgagatgaagatgatcgcaggatatttg
aagaaggcgaaggagtatgctgcaaatgacacacagcgcaagatgatggaggaatatatc
aagcatttcactacgggtgacatgaaagcccacaaggaatcacagaaattatgggtcaaa
gatcttgctcctgtagttgaaacagatacaggcttcatcgagacatacagggatcctgca
ggtatcataggcgagtatgaatctcttgttgccgtaaggaacaaagaacagaccaaaaaa
tttgctgaaatggtggcagctgcggaaaagttcctttctctacttccttgggggcctgaa
tatgagaagccagtattccaggcacccgacttcacttctttggaagttttagcgttcact
gggagcggcattccttctggtataaatattccaaactatgatgacgtgcggcaaaacgtt
ggcttcaaaaatgtgtctttaggtaatgtggtcagtgccccaatcaaagaccagaaccct
acctttttatctgatacagatggagagatattcaataagtattacattgatgcatatgag
gtgcaggtcggtattcacgagctcttgggccatggctctggcaaactattgtctgagcta
ccagatggttccttcaactttgacataaaaaatccgccactcggagttgacggaaaacct
gtttctacatactatgccaagggtgaaacttgggcctccaagtttgggccgttggccggc
ccatttgaagagtgtcgtgctgaggtcatttccatgtatctctatactaatcgagaacta
ttgtcaatctttggcttcaccaccaaagaggagcaagataaaatcatctacacttcctat
ctcgtaatgattcggtcaggcttgatggccttggacttttgggaccccgctaccaagaat
tggggccaggctcatatgcaggctcgtttctctatcttgaagacatttttggaatattcc
ccaaacaaagaattactgaaactaacctactctcaatctgactttgatgatctaaagatt
gagttacgtgctgacctcattgaaaccgctggccacgagtcaatgaaggattatttgaga
cacttgcacatatacaaggcaactggtgattttgagaatgggtcgaagtacttcgttgat
agaagcaccgtcacgcccgaattggcaaagtttagggacgtggtgcgcaagaagaagctt
ccacggagacagtttatccaggccaattcggttttgaatactaagggacaagttttgttg
cgcgaatacaagtcaaattttgaaggaatgattgagtctttcgttgagagagaatactaa

DBGET integrated database retrieval system