KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER364WHelp
Entry
AGOS_AER364W      CDS       T00167                                 

Definition
(RefSeq) AER364Wp
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00010  Glycolysis / Gluconeogenesis
ago00020  Citrate cycle (TCA cycle)
ago00620  Pyruvate metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01130  Biosynthesis of antibiotics
ago01200  Carbon metabolism
Module
ago_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGOS_AER364W
   00020 Citrate cycle (TCA cycle)
    AGOS_AER364W
   00620 Pyruvate metabolism
    AGOS_AER364W
Enzymes [BR:ago01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AGOS_AER364W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 4621436
NCBI-ProteinID: NP_985220
UniProt: Q756A3
Position
V:1311645..1313006
Genome map
AA seq 453 aa AA seqDB search
MLAFTRIAPKVRTLASVARMQLRTYASYPPHTIIGMPALSPTMTQGNLAVWTKKEGDKLS
PGEVLAEVETDKAQMDFEFQEEGFLAKILVPEGAKDVPVNKPIAVYVEEEGDVAAFKDFK
VEESAAESKDAPAKEEAAPAKAAPAAAAPAKAAKKSTGSAASGGRIMASPLAKTIALEKG
ISLKEVTGTGPNGRITKEDVEKYLAKAPKKTESAAAPAAATYEDVPISNMRRVIGSRLLQ
SCQSIPSYPISSDISVAKLLKLRQSLNAAGKDQYKLSINDILIKAIAGAAKRVPEANAYW
LEDQGVIRLFKNVDVSVAVATPTGLITPIVKNAESKGLRSISAEIKELGKRAKENKLAPH
EFQGGTICISNLGMNNAVSSFGSIINPPQSTILSIGTLRRVPVEDAGAEYGFTFEDRMNI
TGVFDHRTIDGARAADFMRELKNIIENPLELML
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgtttactagaattgctcccaaggtgagaacccttgcgtcggtcgcgcggatg
cagttgcgcacttatgcgtcgtatccaccacacactatcatcggcatgccagccctttcg
cccaccatgacgcagggcaacctagcggtatggacaaagaaggagggtgacaagttgagc
ccaggtgaagtgctcgccgaggtggagacggacaaggcgcagatggacttcgagttccaa
gaggagggcttcttggcgaagatcttggtgccagagggggccaaggatgtgccagtgaac
aagccgattgcggtgtacgtcgaggaggagggcgacgtggccgcgttcaaggacttcaag
gtggaggagtctgcagctgagtcgaaggacgctccagcgaaggaggaggctgcgcctgcc
aaggctgcgcctgctgctgctgcgcctgcaaaggcggcaaagaagagcaccggtagcgct
gcttccggcggccgcatcatggcctctccactagccaagaccattgcgttggagaagggt
atttctctgaaggaggtgaccggcaccggtcctaacggccgcatcaccaaggaggacgtc
gagaagtacttggccaaggcgccaaagaagaccgaaagcgctgctgcgccagctgctgca
acgtacgaagacgttcctatcagcaacatgagacgtgtcatcggttcgcgtttgctgcag
tcctgccagagcattccttcgtatcctatctcgtccgacatatcagtggccaagctgcta
aagttgaggcagtctttgaatgctgctgggaaggaccagtacaagctctccatcaatgat
atcctcatcaaggcgattgccggcgctgccaagcgtgtgccagaggccaacgcctactgg
ttggaggaccaaggtgtgatccgcctgttcaagaacgtcgacgtctctgtggccgtcgcc
acccctaccggtctaatcaccccaatcgtgaagaatgccgagtccaagggcctacgctct
atctctgcggagatcaaggagttgggtaagcgtgcgaaggagaacaagcttgcgccacat
gagttccagggtggtaccatttgtatctcgaacttgggcatgaacaacgccgtctcctcc
ttcggctctatcattaaccctcctcagtccaccattctatccattggtaccttgcgcaga
gtccctgttgaggacgccggtgcagagtacggttttacctttgaggacagaatgaacatc
accggtgtgttcgaccacagaaccatcgacggtgccagagctgcggacttcatgcgtgag
ttgaagaacatcatcgagaacccattggaattgatgttgtaa

DBGET integrated database retrieval system