KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFL129W
Entry
AGOS_AFL129W      CDS       T00167                                 

Definition
(RefSeq) AFL129Wp
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
SSDB
Motif
Pfam: Polysacc_synt_4 NitrOD1 ArdA
Other DBs
NCBI-GeneID: 4621648
NCBI-ProteinID: NP_985421
UniProt: Q755F2
Position
VI:192828..193265
AA seq 145 aa
MSTFNAETADNLEDIEKQFAVVAVEQAETYWGLISKVPGSKLRLTKYDDEIYETFMEHFP
EYRDIERVARFQEEELKTKEAKERWRKFIGLFEKKIDDFNFGTLLRTDARQEYGQFTTCF
VVRLQFYAFEIARNKHGLNDWAVGH
NT seq 438 nt   +upstreamnt  +downstreamnt
atgtcgacgtttaacgctgagacggcggacaacttggaggatattgagaagcaattcgct
gtggtggcagtggagcaggcggagacgtactggggccttattagcaaggtgccaggctcg
aagctgcggctgacgaagtacgacgatgagatctatgagacgttcatggagcacttcccc
gaataccgggacatcgagcgcgtggctcgtttccaggaggaggagctgaaaacgaaggag
gccaaggagcggtggcggaagtttatcgggttgttcgagaagaagatcgacgacttcaac
ttcggcacgctgctgcgcacggacgcgcggcaagagtacgggcagttcacgacgtgcttc
gtggtccgtctgcaattctacgcgtttgagattgcgcggaacaagcatgggctgaacgac
tgggccgtaggccactga

DBGET integrated database retrieval system