KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR346W
Entry
AGOS_AFR346W      CDS       T00167                                 

Definition
(RefSeq) AFR346Wp
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00100  Steroid biosynthesis
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
Module
ago_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:ago00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    AGOS_AFR346W
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     AGOS_AFR346W
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 4622160
NCBI-ProteinID: NP_985893
UniProt: Q753G6
Position
VI:1066763..1068079
AA seq 438 aa
MSEAPLNPRTRSYEFYGVPGVLAISVGLPVLTIVLNQLIRADYYIVGPFSNFHWEQVWNH
LKPFSHYLYNSELWTYYMAWLFVLAFLDVTLPGRKMRGVVLRDGSQLQYKINGIAMVSAL
VLILCVRWNVTRGDMPELQYIYEHHTDICIITVLFSVVLATLTYICSFLPQLRRNKRGTK
ERILALGGNTGNPIYDWFIGRELNPRLGALDVKLFCELRPGMLLWLLINLSCLHQHYINT
GQLNDALLLVNILQGFYILDGVLNEEGLLTMMDITTDGFGFMLAFGDLALVPFTYSLQAR
YLSVSPIELGRNRIAAICAVMLIGYWIFHSSNTQKSNFRQGKLPHLKSIQTTRGTKLLCD
SWWAMSQHINYFGDWLISLSWCLCTGFQTPLTYYYSLYFAALLLHRQTRDEEKCRQKYGD
SWKEYESQVPYKIIPYLY
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgagcgaagcgcctctcaatccgcgcaccaggtcgtatgaattttatggcgttccaggg
gtattggccatctcggtcggcctaccggttctgacaattgttctcaaccagctgatcagg
gcagactactacatagtcgggccgttctcgaacttccactgggagcaagtatggaaccat
ctgaagcctttctcgcactatttgtataacagcgagctgtggacctactatatggcatgg
ctgttcgtactggcgtttctggatgtgacgctgcctggtcgcaaaatgcgcggtgttgtt
cttcgggacgggtcgcagctgcaatacaagatcaatgggatagctatggtatccgctcta
gtcctgatcctgtgcgtgaggtggaatgtaacgcgtggcgacatgcctgagttacagtat
atttacgagcaccacaccgacatctgcatcatcaccgtgcttttttcggttgtgctggcg
accctcacctacatctgcagctttctaccgcaactgcgccggaacaagcgtgggacgaag
gaacggatccttgcgctaggtggcaatacgggaaatccgatatacgactggttcatcggc
cgcgagctcaacccaaggctgggggcgctcgatgttaaattgttctgcgaacttcgtccc
ggaatgctactgtggcttctgattaatctttcctgcttacaccagcactatatcaatact
ggccaactcaacgatgcattgctgctagtgaatattctgcagggattttacatattagat
ggcgtactcaacgaagagggtctactgacaatgatggatatcactaccgatggcttcggc
ttcatgctcgcgtttggcgatttagcgcttgttcccttcacctattctctacaggctcgc
tatttgtccgtttcaccgatcgagctcgggcgcaatcggatcgcggctatctgcgcggtc
atgcttatcggctactggatcttccactcttcgaacacccaaaagtcgaacttcagacag
ggcaagctgcctcacctgaaaagcatccagactacccgtggaaccaaacttttgtgtgat
tcatggtgggccatgtcccagcatatcaattactttggtgattggctcatctctctcagc
tggtgcctatgcacaggtttccaaacacctctgacatactattactcgctctactttgct
gcccttttgctacaccggcaaaccagagatgaggagaagtgcagacaaaagtatggtgat
agctggaaagagtacgagtcacaggtgccatacaaaatcataccctatctgtactga

DBGET integrated database retrieval system