KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR603CHelp
Entry
AGOS_AFR603C      CDS       T00167                                 

Definition
(RefSeq) AFR603Cp
  KO
K08735  DNA mismatch repair protein MSH2
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ago00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AGOS_AFR603C
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ago03400]
    AGOS_AFR603C
DNA repair and recombination proteins [BR:ago03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     AGOS_AFR603C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MutS_V MutS_III MutS_IV MutS_II MutS_I AAA_27 Apt1
Motif
Other DBs
NCBI-GeneID: 4622435
NCBI-ProteinID: NP_986150
UniProt: Q752H0
Position
VI:complement(1528810..1531680)
Genome map
AA seq 956 aa AA seqDB search
MSSVRPELKFSDASEERGFYRRFASLPPKPSQTIRIVDRGEYYTILGQDAIFVAENVYHT
QAVLKDFRVDAAVAKQLAEPTKYVTMSPQVIASLLKMALLEQGFKVEIYDRSWKLLKSAS
PGNIDQVDDLMNVSVDSSVVLASVKFQFNASDGFCVLGVSYVDSNSYKIGMLDIVDNEVY
SNFESFLIQLGVKECLLPDLRNNESFSAELKKVTGVIERCGCVVTFVKNSEFNNKDVEAD
LAKLCGDELATSLPRFSKLALASCNALIGYQQLLNNAGNEGSYQIVEYSLSEFMKLDASA
VKALSIFPQGPSTQSGMATSGKFGGNGKITSLLQLLNKCKTNAGVRLLNEWLKQPLSDKG
SIEKRHNLVDYLVDQLELRSILRDDYLPLVPDVRRLTKKLNRNGSLEDVLKVYQFAQRIP
EINGVLKENLDALSEGSHVKDLVLETWYNPLNEHVEPLHKFQEMVETTVDLEAYEETNEF
MIKVEFNDELARIRTELVDLKDKIRTIHLDTSDDLGFDPEKKLKLENHHVHGWCMRLTRN
DAKALRQHKKYLELSTVKAGIYFSTKELKLLSDEIGTLQQDYDRKQSALVKEIVTITLSY
SPVLEKLSLVLANLDVLCSFAHVSSYAPIPYVRPVMYDMHAGQRKMELLASRHPLVEAQD
EVTFISNDVVLEADSSGFAIITGPNMGGKSTYIRQVGVICLLAQIGCFVPCDAAEITIVD
AILCRVGAGDSQLKGVSTFMAEMLETASILRNATKNSLIIIDELGRGTSTYDGFGLAWSI
SEHIAKNIGCFALFATHFHELTALADDCPNVTNLHVVAHVEEKSHKSDDITLLYKVEPGI
SDQSFGIHVAEVVQFPSKIVKMAKRKATELDDIKEETECLKKLKCSPEHIAKGSEVLKNL
LQEWASILRAENLDQQLDDESIQELCIDKLRSLVNSSDELNSCEKNFKDWVTAQLL
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagtgaggccagaattaaaattttcagacgcttctgaggaacggggcttctat
agacgctttgctagtcttccccccaagccatctcagacgatccggatcgtggaccggggc
gaatactataccatcctgggacaggacgctatatttgtggcggaaaatgtctaccacacg
caagcagtgctcaaggacttccgggtggacgctgctgtcgcgaagcagctggcggagcct
acgaagtacgttacgatgtcgccgcaggttattgcttcgcttttgaagatggcactgctt
gaacaggggtttaaggtggagatatatgaccgcagctggaaattgttgaagtcagcatcc
cccggaaatatcgaccaagttgatgacttgatgaacgtgtcggttgattcgtcggtggtg
ttggccagcgtcaagtttcagttcaacgcatcggatggcttttgtgtgctcggtgtctcg
tacgtagacagcaattcgtacaagatcgggatgttagacattgtggataacgaggtctac
tcgaacttcgagagttttctcatccagctgggggtgaaagaatgtctgctgccagacttg
aggaataacgagtcgttcagcgcagagctcaagaaggtaaccggtgttattgaacggtgc
ggctgcgtggttacgtttgtcaagaactctgagttcaacaacaaggacgtagaagcggac
ctcgctaaactctgtggagacgagctggccacatcgctgccgcgtttttccaagttagca
ttggcttcctgtaacgccctaattggataccaacagcttttaaataatgctggtaacgaa
ggatcctatcagattgttgagtattctctatccgagtttatgaagttggatgcatctgcc
gtcaaggcactgagtatatttccgcaagggcctagtacacagtcaggtatggccacctca
gggaagtttggtggaaatggcaagattacaagccttttgcaacttctgaacaaatgcaaa
actaatgccggcgttaggctgctaaatgaatggctgaagcaaccacttagcgacaaaggt
tcgatagaaaagcgtcacaatttggttgactacctggttgaccagttggagctgagatct
attctccgcgacgactatctcccgcttgttcctgatgttcggcgcttaacgaaaaagctc
aaccgcaatgggtccttggaagatgttttgaaggtctatcaatttgcgcagcgcattcct
gagattaatggtgttttgaaggaaaatttggacgccttgtctgagggatcacatgttaag
gatttggttcttgagacatggtataacccgctgaatgaacatgtagagcctttgcacaaa
tttcaagagatggttgaaactactgttgatttggaggcatatgaagaaacaaacgagttt
atgatcaaggtagaatttaacgatgagcttgctcgcataagaactgaacttgttgatctt
aaggataagattagaactatccacttagatacttcagatgatcttggttttgatccagag
aagaaactaaagctggagaatcatcatgttcacggatggtgcatgagacttacgcgaaat
gatgcgaaggctttgaggcagcacaagaagtaccttgagttgtccacggttaaagcgggt
atttatttcagtaccaaggaattaaagttgttatccgatgaaattggaacattgcagcaa
gattacgacaggaaacaatcagcattggtaaaggaaattgttactattacactgtcttat
tcccctgttcttgagaagctttctctggtattagccaacttggatgtcttatgctcattt
gctcatgtatcgagttacgctccaattccatacgtgaggccagttatgtatgatatgcat
gcggggcagaggaaaatggaactgcttgcctcccggcatccattggttgaagctcaagat
gaagtcacatttatctcgaatgatgtcgtactagaagccgattctagtggatttgcaatt
attaccgggcctaatatgggcggtaaatccacatatatcaggcaggtaggtgtcatttgc
ctattagcacaaataggatgttttgtaccttgcgatgcagctgagattacgatagtagac
gcgatcctctgtcgtgtaggggcgggtgattctcaactaaagggtgtgtcgacttttatg
gcggaaatgttggaaaccgcctctattctccggaatgctaccaagaattctctgatcatt
attgatgagttgggacgtggaacaagtacatatgatggctttggcctcgcatggtcaata
tcggagcacattgcgaaaaacattgggtgctttgcgctttttgcaacacattttcacgaa
ttgactgccttggctgatgactgccctaatgtcaccaatcttcatgtggtcgcacatgtt
gaagagaagtcccataaatcggatgacataacgctgttgtacaaggttgagcccggtatc
tctgaccaatcgtttggtatccatgtggcggaagttgtccaatttccgagtaagattgtc
aaaatggcgaaacggaaggctacggagttagatgatatcaaggaggagacggaatgccta
aaaaagttaaaatgttcgccagagcacatcgctaagggctctgaggtgctaaagaacctt
ttgcaagaatgggcaagtatcctacgtgcagagaatcttgaccagcaactggacgatgag
tcaattcaagaactatgcattgacaaactacgttccttagtcaactcttcagatgaacta
aattcatgcgaaaagaactttaaagattgggttactgcccaattactatag

DBGET integrated database retrieval system