KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL027W
Entry
AGOS_AGL027W      CDS       T00167                                 

Definition
(RefSeq) AGL027Wp
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
SSDB
Motif
Pfam: OPT DUF4064
Other DBs
NCBI-GeneID: 4622938
NCBI-ProteinID: NP_986639
UniProt: Q750H8
Position
VII:975113..977746
AA seq 877 aa
MDFQQVDTKEKNSDRLPSPCAPASEKDGKAGSQDVPLSDTQELSLLDDEHLILLLHKMGY
KHADLEDIPPVVHYLVARINELTIEKSLTILKKCAVDHAGDPNITEEEATDLERFTSGDF
DHTDETEVFQLKLLAALFYYHSPYPEVRAVVGPGDDPTIPVETFRCYFLTTTITIIGCGL
TTFFQSRYPLIEFSSMAAQFLFFILGTLWSKFMPAVRIPIFPGYGFQLNLQTSWSKKEQM
FATLLYSITTGVFYSYFNILTQDMFYNDPTSLGFQIILSLSLQFMGFGLAGLLRPFVVFP
ARALWPLSMPTIALNNALLAQDVGKGTSIRKVFFYFGIGMFIYNWFPTVFADVLSNLNWL
TWIKPNNFNLAAITGGRYGIATNPLPTLDWNYITHWALALPFYTVFLQYLGSLLSVVIII
AVYYTNYMECQYLPIFGQPLYSNEGKFFDASKVLTDFKLDWQKYQQYSLPYYSAGNIVGY
GSFISLYTLLAAYSIITEYEILGGACKRLGVGLWSLTKLDTWRNLHKNDSSILEGYDDAH
CREMRKYPEVPEWWFFAIFLISLVLAIILVTTYKTNTPVWGIFLAVGLNVAFLLPLTTLQ
STTGASLGLNLLVQMITGYLLPGNPYALMIIKAFGYNIDGQADNYLSNLKMAHYCKIPPV
PLFRGQLSMVLLQVIVSLAVINWQIHNVPDFCNPKNRSGFICQGPRTYYNASIVWGIIGP
KKVFSYLYPMMKWCWLIGALLGVLFGGWCRLSRKYKLYYPRSFNPVVFVTGMISLMPPYN
LRVYTSKLYVAFIGQYWLRRYHLRIWEKYNYVVAAAFNCGVIFSAITIFFAIQYPEIRLD
WILNTINDVGIDATPTPLKDVKLTERGYFGPPRGSLP
NT seq 2634 nt   +upstreamnt  +downstreamnt
atggactttcaacaggtggataccaaagaaaagaactccgacaggttaccatccccttgt
gctccggcctctgagaaagatggaaaggctggctcgcaggatgtgccattgtccgacact
caggaactttcgctgctagacgatgaacaccttattctccttcttcacaagatgggctac
aaacacgcggacttggaagatattccgccggttgttcactatcttgtagcacggataaat
gaattgacaatagaaaagtcactgacgatattgaaaaagtgtgccgttgaccacgctggt
gatccgaatatcacggaggaggaagctaccgacctagagcgctttacttctggcgacttt
gaccacaccgatgagacagaagtctttcagttgaagctacttgctgcattattctactac
cactcgccctatcccgaggttcgggcggttgtgggtcccggagatgatcccactatccca
gtggaaacgttccgctgttacttcctgaccaccaccattactattattggctgtggactg
acaacctttttccaatcccgttatccgttaatcgaattctcctcgatggcggcgcagttt
ttgttcttcatactgggaacgttatggtcgaaatttatgcctgcagttaggatacccata
tttccaggttatggtttccaattgaatttgcagacttcttggtccaagaaggaacaaatg
tttgccacgctgctgtacagtattactacaggcgtcttctattcttattttaatatcttg
acgcaagatatgttttataatgatcccacatcgttagggttccaaataatcctatctcta
tcgctacagttcatggggttcggacttgcgggtcttctgaggcctttcgtggttttcccc
gcacgcgcactttggccattatctatgcccacaatagctttgaacaatgcactacttgcc
caagatgtgggaaaaggtactagtatcaggaaagttttcttttactttggaattggcatg
tttatctacaactggttcccgacggtttttgctgatgtgctcagcaacctgaattggcta
acctggattaagccaaataacttcaatctcgctgccattactgggggcaggtacggtatt
gctacaaacccattgcctaccttagattggaattatatcacacattgggcattggcgtta
ccattttatactgttttcttgcaatatctcgggtccttactttctgttgtgattataata
gcagtttactacactaactacatggaatgtcagtatttgccgatatttggtcaaccattg
tatagtaacgaaggaaagtttttcgacgccagtaaagtgcttactgattttaaattagac
tggcaaaaataccaacagtattcactgccatactattcagctggaaatattgttggatat
ggctcgtttatttctctatacacgctccttgctgcatacagtattatcacagagtatgaa
attctaggtggcgcttgcaaacgattgggggttggattgtggtctctaacgaagttagat
acttggaggaatcttcacaaaaatgactcctctatccttgagggttacgacgatgcacac
tgccgcgaaatgcgcaagtacccggaagttcccgaatggtggttctttgctatcttcctt
atatctctggtattggcgattatattggttactacatacaagaccaatacacctgtgtgg
ggcatcttcttggctgttggtctcaatgttgcattcttattaccactaacaactcttcaa
tcaacgacaggtgcaagtctcggtctcaatttgctcgtgcagatgataacaggttacttg
cttcccggaaacccttacgccctcatgatcatcaaagcttttggttataacatcgatggc
caagccgacaactacttatcaaatctgaaaatggctcactattgcaaaatacctccagtg
cctctattccgcggtcaattgtccatggtgctgctgcaggtcattgtcagtcttgctgtt
attaattggcagattcataatgtccctgatttctgtaatccaaaaaacagaagcggcttt
atttgccaaggccccaggacatactacaatgcgtctattgtatggggaataattgggcca
aagaaggtgttcagctacttatacccgatgatgaaatggtgttggctaattggtgcactg
ttaggagtgcttttcggaggctggtgccgcttgtctaggaaatacaaactctattatcca
cgcagcttcaatccggtggtctttgtgacaggtatgatttcattgatgcctccgtataac
ctaagagtttacacatccaagctttatgtggcctttattggccagtattggctcagaagg
tatcatctgcgaatttgggaaaaatacaactatgtggttgctgcagccttcaactgtgga
gttatattttcagctatcacgatattctttgcgatacaatatccagaaataagattagac
tggattctcaatacgattaacgatgttggtatcgatgcaacccctacacctctaaaagat
gtcaaacttaccgaaagaggttattttggcccaccccgggggagccttccttag

DBGET integrated database retrieval system