KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL200WHelp
Entry
AGOS_AGL200W      CDS       T00167                                 

Definition
(RefSeq) AGL200Wp
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00020  Citrate cycle (TCA cycle)
ago00310  Lysine degradation
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01130  Biosynthesis of antibiotics
ago01200  Carbon metabolism
Module
ago_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ago_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGOS_AGL200W
  Amino acid metabolism
   00310 Lysine degradation
    AGOS_AGL200W
Enzymes [BR:ago01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AGOS_AGL200W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl HlyD_3 GCV_H Biotin_lipoyl_2 RnfC_N HlyD_D23 CCDC53
Motif
Other DBs
NCBI-GeneID: 4622760
NCBI-ProteinID: NP_986467
UniProt: Q751B0
Position
VII:323344..324654
Genome map
AA seq 436 aa AA seqDB search
MLRSTLRVTSRAARPLAASMGRSSAVHAGAAAQAKLYSQIQMGAMHGPALQHLCGLRYAS
TSVQVPPMAESLTEGSLKEFTKQVGEYIEQDELLATIETDKIDIEVNAPVSGTVTKLNFK
PEDTVTVGEELAQIEEGAAPAGGQKPAAKEETSAPQEAAPASPAAKEEKPQAAKPAQAAP
AKEQPKQAAAQSSTVSAGASVSGFARTERRVKMNRMRMRIAERLKEAQNTAASLTTFNEV
DMSALLEMRKLYKDEILKTKGVKFGFMGLFAKAVALAQKEVPAVTGGIEGDQLVYRDYTD
ISIAVATPKGLVTPVVRNVESLSVLEIEQEISRLGQKAREGKITLEDMAGGNFTISNGGV
FGSLYGTPIINTPQTAVLGLHGVKERPVTVNGQIVSRPMMYLALTYDHRMLDGREGVTFL
KTIKELIEDPRKMLLV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatctaccctacgtgtaacaagcagggcggccaggccattggcagcgtccatg
ggcagaagcagcgcagtacacgccggcgcggccgcgcaggccaagctatacagccagatc
cagatgggcgctatgcacggcccggcgttgcagcacctatgtggactgcggtacgcctcg
acgtcagtgcaggtgccacccatggccgagtcgttgacggagggttcgctcaaggagttc
acaaaacaggtgggcgagtatatcgaacaggacgagcttttggcgacgattgagacggat
aagatcgacatcgaggtcaacgcgcccgtgtccgggactgttacaaagttgaacttcaag
cccgaggacacagtgaccgttggcgaggagttggcacagattgaggagggcgccgctccg
gcaggtgggcagaagcctgccgcgaaagaggagacgtctgctccacaggaagccgctccg
gcgtcgcctgcggcaaaggaggagaagccacaggccgccaagcccgcgcaggccgcccct
gccaaggagcagccaaagcaagcggccgcgcagagctctaccgtgagcgccggcgcttct
gtcagcggttttgcgcgtactgagcgcagggtgaaaatgaaccgcatgaggatgagaatc
gctgagcggttaaaggaggcacagaacaccgcggcctctttgaccaccttcaacgaggtc
gacatgtccgcacttcttgagatgcgcaagctgtacaaggacgagatcttgaaaaccaag
ggcgtcaagttcggcttcatgggcctctttgcgaaggcagttgctctagcccagaaggag
gttcctgccgtcaccggtgggattgagggtgaccagcttgtctaccgcgactacaccgac
atttcgatcgctgttgcaacccccaagggtctcgtcacgcctgtggtgcggaatgtcgag
tctctctccgtcctagagattgagcaggagatttcaagattgggccagaaggcccgtgag
gggaagatcaccctagaggacatggccggtggcaactttaccatctccaacggtggtgtt
ttcggctccttatacggcactccaatcatcaacaccccacagactgctgttttgggtttg
cacggcgtaaaagagagaccagtcaccgtcaatggccagattgtttctagaccaatgatg
tacttggccttgacttatgaccacagaatgctagatggaagagagggtgtcacgttccta
aagacaatcaaggaattgattgaggacccaaggaagatgctccttgtttga

DBGET integrated database retrieval system