KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR183C
Entry
AGOS_AGR183C      CDS       T00167                                 
Name
(RefSeq) AGR183Cp
  KO
K11252  histone H2B
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
KEGG Orthology (KO) [BR:ago00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ago03036]
    AGOS_AGR183C
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ago04147]
    AGOS_AGR183C
Chromosome and associated proteins [BR:ago03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    AGOS_AGR183C
Exosome [BR:ago04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AGOS_AGR183C
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W
Other DBs
NCBI-GeneID: 4623151
NCBI-ProteinID: NP_986849
UniProt: Q74ZL5
Position
VII:complement(1412493..1412891)
AA seq 132 aa
MSSKASKAPASKAPAEKKPAAKKTSSSVDASKKRTKTRKETYSSYIYKVLKQTHPDTGIS
QKSMSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGT
RAVTKYSSSTQA
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtcgtccaaagcatccaaggcccctgcctccaaggcccccgccgagaagaaacccgcc
gccaagaagacgtcgtcctccgtggacgcgtccaagaagcgcaccaagaccagaaaggag
acctactcctcgtacatctacaaggtcctgaagcagacccaccccgacaccggtatctcc
cagaagtccatgtccattctgaactccttcgtcaacgacatctttgagcgcattgcctcc
gaggcctccaagctggccgcgtacaacaagaagtctaccatctccgcgcgtgagatccag
actgccgtgcgtctgatcctaccgggtgagctggccaagcacgcggtctccgagggcacg
cgcgccgtcaccaagtactcgtcttccacgcaggcttga

DBGET integrated database retrieval system