KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGR200WHelp
Entry
AGOS_AGR200W      CDS       T00167                                 

Definition
(RefSeq) AGR200Wp
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00260  Glycine, serine and threonine metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01130  Biosynthesis of antibiotics
ago01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ago00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AGOS_AGR200W
Enzymes [BR:ago01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AGOS_AGR200W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 4623168
NCBI-ProteinID: NP_986866
UniProt: Q74ZK0
Position
VII:1445911..1447050
Genome map
AA seq 379 aa AA seqDB search
MLPARYLTSRNDFRSDTFTLPTAEVWAAGAGASLGDTVYQEDTDTCALEARVAQEFGGAR
GGDAAGLMCVSTTMANQLAVRALLDRAPPYSVLCDRRAHVYVDECAGLAVLSQALVIPAE
AANGRHLTLEDVQRAYVPDDGDTHGAPTRVVALENTLHGMCFPLEEMRRICDWAHAQGML
VHLDGARLWNAAAAQPGDAAAYMRRVCALFDSVSLCLSKSVGAPVGSVLVGGRDLIRRAR
HLQKQQGGGIRQAGFLARMADYCITKNVPGLGDVAARAAAFWRDLHDDLRDHHGMQLHLA
HPVETNFVFIDLERSGIEPSRLLEFGAKNDVRLFDGRLAFHFQNVEDSSLAQLKQVFVDL
AAYYREHPYVAPAGPQRRY
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttgccggcgcggtatctgacatcgaggaacgacttccggtcggacacgttcacgctg
ccgacggcggaggtgtgggcggcgggcgcgggcgcgtcgctgggggacacggtctaccag
gaggacacggacacgtgcgcgctggaggcgcgggtggcgcaggagttcgggggcgcgcgc
ggcggggacgcggcggggctgatgtgcgtgtcgacgacgatggcgaaccagctggcggtg
cgtgcgctgctggaccgggcgccaccgtactcggtgctgtgcgaccggcgcgcgcatgtg
tacgtggacgagtgcgcggggctggcggtgctgtcgcaggcgctggtgattcctgcggaa
gccgcgaacgggcggcacctgacgctggaggacgtgcagcgcgcgtacgtgccggacgac
ggcgacacgcacggcgcgccgacgcgcgtcgtggcgctggagaacacgctgcacgggatg
tgctttccgctggaggagatgcggcgcatctgcgactgggcgcacgcgcaggggatgcta
gtgcacctcgacggcgcgcggctgtggaacgcggccgcggcgcagccgggcgacgcggcg
gcgtacatgcggcgcgtgtgcgcgctgttcgactccgtgtcgctgtgcctgtcgaagtcc
gtgggcgcgccggtgggctccgtgctggtgggcggccgcgacctgatccggcgcgcgcgc
cacctgcagaagcagcagggcggcggcatccgccaggccgggtttctggcgcgcatggcg
gactactgcatcacgaaaaacgtgcctgggctgggcgacgtcgctgcgcgcgcggcggcg
ttctggcgggatctgcacgacgacctgcgtgaccaccacggtatgcagctgcatctagcg
cacccggtggagaccaactttgtgttcatagacctggagcgctcgggcatcgagccctcg
aggctgctggagttcggcgccaagaacgacgtgcggcttttcgacgggcggctggcgttc
cacttccagaatgtggaggacagctcgctggcgcagctcaagcaagtctttgtcgacctg
gccgcctattaccgagagcatccgtacgtggcccccgctggcccccaacgccgctactag

DBGET integrated database retrieval system