KEGG   Agrobacterium sp. H13-3: AGROH133_04462Help
Entry
AGROH133_04462    CDS       T01432                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00260  Glycine, serine and threonine metabolism
agr00750  Vitamin B6 metabolism
agr01100  Metabolic pathways
agr01110  Biosynthesis of secondary metabolites
agr01120  Microbial metabolism in diverse environments
agr01230  Biosynthesis of amino acids
Module
agr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AGROH133_04462 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AGROH133_04462 (thrC)
Enzymes [BR:agr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AGROH133_04462 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADY63715
UniProt: F0L7M4
Position
circular:complement(741246..742643)
Genome map
AA seq 465 aa AA seqDB search
MKYVSTRGAAPSLGFCDALLAGLGRDGGLYVPREWPSMSKKEIRNLRGKSYQDIAFEVLY
RFTGGEIPADKFRAMIDDAYATFRHPAVAPLTQTGPNTFVLELFHGTTLAFKDVAMQLLA
RLMDYTLAERGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPNGKVSPVQQRQMTTS
TASNVHALAINGNFDDCQNLVKEMFNDAKFRDGVKLSGVNSINWARIMAQVVYYFTASLS
LGGPDRKISFTVPTGNFGDIFAGYVAKKMGLPIDKLVIATNDNDILARTLKTGRYEMRGV
TPTTSPSMDIQISSNFERLLFEAYGRDSAAVKASMDGLKQSGAFEIPPHALKFIKKDFRA
GRATEKQVAATIRDTLEKTGYLIDPHTATGVFVAEKHEKASSPMVVLSTAHPAKFPAAVK
SACAIDPALPVWLADIMNREERFDILDAELKTVETFIGSHARAGK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatgtatcgaccaggggtgcggccccttcgcttggtttctgcgacgcgcttctg
gcgggccttggccgtgatggcgggctttacgtgccgcgcgaatggccctccatgtcgaaa
aaggaaatccgcaacctgcgcggcaagtcctatcaggacatcgcgtttgaggttctctac
cgtttcaccggcggtgaaattccggccgacaagttcagggcgatgatcgacgacgcctat
gcgacgttccgccatccggccgtagcacccctgacgcagaccgggccaaacaccttcgtg
ctggagcttttccacggcaccacgcttgccttcaaggacgtggcgatgcagcttctcgcc
cgcctgatggattatacgctggctgagcgcggcgagcgcgccaccatcgtcggcgccacc
tccggcgacaccggcggcgcagccatcgatgcctttgccgggcgcgagcgcaccgacatc
ttcatccttttccccaatggcaaggtctctccggtgcagcagcgccagatgacgacctcc
accgcctccaacgtgcatgcgctggcgatcaacggcaatttcgacgattgccagaacctc
gtcaaagaaatgttcaacgacgcgaaattccgcgacggcgtcaagctttcgggcgtcaac
tccatcaactgggcgcgcatcatggcgcaggtggtctattatttcacggcgtccctgtcg
ctcggcggtcccgaccggaagatttccttcaccgtcccaacgggcaatttcggtgatatc
ttcgccggttacgtcgccaagaagatgggcctgccgatcgacaagcttgtcatcgccacc
aacgacaacgacattctggcgcgcacgctgaagaccggccgttacgagatgcgcggcgtc
acgcccaccacctcgccctcgatggacatccagatatcctcgaatttcgagcggctgctg
tttgaggcctatggccgcgattccgctgcggtaaaggcatcgatggatggcctcaagcaa
tccggcgcgtttgaaatcccgccgcatgcgctgaaattcatcaagaaggatttccgcgcc
ggccgcgccaccgaaaagcaggtggcggcgacgatccgcgatacgcttgagaaaaccggt
tacctgatcgacccgcatacggcgaccggcgtttttgtggcggaaaaacacgaaaaggca
tcaagcccgatggtggtcctgtccactgcccatccggctaaattcccggccgccgtaaaa
tccgcttgcgcaatcgacccggcgcttccagtatggctagctgacattatgaaccgggag
gagcgtttcgacattctggacgcagagctgaagacggtggaaaccttcatcggcagccac
gcacgcgccggcaaatag

DBGET integrated database retrieval system