KEGG   Agrobacterium sp. H13-3: AGROH133_06354Help
Entry
AGROH133_06354    CDS       T01432                                 

Gene name
fdhA
Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00625  Chloroalkane and chloroalkene degradation
agr00680  Methane metabolism
agr01100  Metabolic pathways
agr01120  Microbial metabolism in diverse environments
agr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    AGROH133_06354 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AGROH133_06354 (fdhA)
Enzymes [BR:agr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     AGROH133_06354 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADY64505
UniProt: F0L564
Position
circular:1518794..1520056
Genome map
AA seq 420 aa AA seqDB search
MSFDDILSAEERAGIGVQPKEEMDMSKNRGVVYLRPGQVEVRDIDDPKLEAPDGRRIEHG
VILKVISTNICGSDQHMVRGRTSAMPGLVLGHEITGEVIEKGVDVEMLDIGDIVSVPFNV
ACGRCRCCKSQDTGVCLTVNPARAGGAYGYVDMGGWIGGQARYVTIPYADFNLLKFPDRD
RAMSKIRDLTMLSDILPTGFHGAVKAGVGVGSTVYVAGAGPVGLAAAASARILGAAVVMI
GDFNKDRLAHAAKVGFEPVDLSKGDRLGDMIAEIVGTNEVDSAIDAVGFEARGHSGGEQP
AIVLNQMMEITRAAGSIGIPGLYVTEDPGAVDAAAKQGSLSLRFGLGWAKAQSFHTGQTP
VLKYNRQLMQSILHDRLPIADIVNAKIIALDDAVQGYESFDQGAATKFVLDPHGDLLKSA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgacgatatcctgtccgcggaggagcgggccggtattggtgttcaacccaag
gaggagatggatatgagcaaaaacagaggcgtcgtctatttgcgccccggccaggtcgag
gtccgcgacatcgatgatccgaagctggaggcgccggatggccgccgtatcgagcacggt
gtcattctcaaggttatttccacgaatatctgcggttcggaccagcatatggtgcgcggc
cgcacctcggcgatgcccggcctcgtccttggccatgagatcaccggcgaagtcattgaa
aaaggcgtcgacgtcgagatgcttgatatcggcgatatcgtctcggtgccgttcaacgtc
gcctgcggtcgctgccgctgctgcaagtcgcaggataccggcgtgtgcctgacggtgaac
cccgcccgtgccggcggcgcctacggttatgttgatatgggcggctggatcggcggacag
gccagatacgtcaccattccctatgccgacttcaaccttctgaaatttcccgaccgcgac
agggcaatgtccaagatccgcgaccttaccatgctctcggacatcctgccgaccggcttt
catggcgcggtcaaggccggcgtcggtgtcggctccacggtctatgtcgcgggcgccggt
ccggtcggtctggcggctgccgcatctgcccgtattctcggtgccgccgtcgtcatgatc
ggtgatttcaacaaggatcgccttgcgcacgccgccaaggtcggcttcgagcccgtcgat
ctttccaagggcgaccggctgggcgacatgattgccgagatcgtcggcaccaacgaggtc
gacagcgccatcgatgccgtcggtttcgaagcgcgtggccattcgggcggcgaacagccg
gccatcgttcttaaccagatgatggaaatcacccgtgccgccggctcgatcggcattccc
ggcctttacgtcaccgaagacccaggtgcggtcgatgccgcagcaaaacagggcagcctg
tcgcttcgcttcggtctcggttgggccaaggcacaatctttccataccggccagacgccg
gtgctgaaatacaatcgccagctcatgcagtcgatcctgcacgaccgcctgcccattgcc
gacatcgtcaatgccaagatcatcgcactcgacgacgccgtacagggatatgaaagcttc
gaccagggtgccgcaaccaagttcgtgctcgatccgcatggcgatctgctgaagtcggcc
tga

DBGET integrated database retrieval system