KEGG   Agrobacterium sp. H13-3: AGROH133_08851Help
Entry
AGROH133_08851    CDS       T01432                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00020  Citrate cycle (TCA cycle)
agr00310  Lysine degradation
agr01100  Metabolic pathways
agr01110  Biosynthesis of secondary metabolites
agr01120  Microbial metabolism in diverse environments
agr01130  Biosynthesis of antibiotics
agr01200  Carbon metabolism
Module
agr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
agr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AGROH133_08851 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    AGROH133_08851 (sucB)
Enzymes [BR:agr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AGROH133_08851 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Fim-adh_lectin
Motif
Other DBs
NCBI-ProteinID: ADY65548
UniProt: F0L3F3
Position
circular:complement(2598188..2599420)
Genome map
AA seq 410 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDTVKADEPLVELETDKVTVEVPAPASGVLTEIV
VQNGETVGLDALLGQIAEGAAGAATSAPAAKSAAPAAAPAPAAAVAAAPAGSAMPPAPAA
GKLLAENNLSADQVDGSGKRGQVLKGDVLAAVAKGVSAPAAAPVAAAAPRPVSAEQDQVR
EERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMDLRNRYKDVFEKKHGVKLGFM
GFFTKAVTHALKELPAVNAEIDGTDIIYKNYCHVGMAVGTDKGLVVPVIRDADQLSIAGV
EKELGRLAKAARDGSLGMADMQGGTFTITNGGVYGSLMSSPILNAPQSGILGMHKIQERP
VAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaaatccgcgtaccaaccctcggcgaatccgtcagcgaagcgaccgtcggc
acctggttcaagaaggtcggcgataccgtcaaggccgacgaacctctcgttgaactcgaa
accgacaaggttaccgtcgaagttccggcgcccgcctccggcgtgctgaccgaaatcgtc
gtgcagaacggcgaaaccgtcggtctcgacgcccttctcggccagatcgccgaaggtgct
gccggcgctgcaacttctgcacccgcagcaaagtctgctgcgcctgctgctgcaccggca
cctgccgcagccgtggccgccgctccggctggaagcgccatgccgccggcacctgccgcc
ggcaagctgctcgctgaaaacaacctttccgccgatcaggtcgacggttcgggcaagcgt
ggccaggttctgaagggcgacgttctcgccgctgttgccaagggtgtttcggcacctgcc
gccgctccagtcgctgctgctgctccccgtccggtttcggccgagcaggatcaggttcgc
gaagagcgcgtcaagatgacccgcctgcgccagacgatcgcacgtcgcctcaaggatgca
cagaacacggccgccatgctgaccacctataacgaggtggacatgagcgccgtcatggat
ctgcgcaaccgctacaaggacgttttcgagaagaagcacggcgtcaaactcggctttatg
ggcttcttcaccaaggccgtgacccacgcgctgaaggaactgcccgccgtcaacgctgaa
atcgacggcacggacatcatctacaagaactattgtcacgtcggcatggctgtcggcacc
gacaagggtctcgtcgttccggtcattcgcgatgccgaccagctctccatcgctggtgtc
gaaaaggaactaggccgtctcgccaaggcagcgcgcgacggttcgctcggcatggccgac
atgcagggcggcaccttcaccatcaccaatggcggcgtctacggctcgctgatgtcctcg
ccgatcctcaatgcgccgcagtcgggcatcctcggcatgcacaagatccaggagcgtccg
gtcgccatcggcggtcaggtcgtcatccgtccgatgatgtatcttgcgctctcctacgat
caccgtatcgttgacggcaaggaagccgtgaccttcctcgttcgcgtcaaggaaagcctc
gaagatccggaacgtctggttctcgatctctga

DBGET integrated database retrieval system