KEGG   Agrobacterium sp. H13-3: AGROH133_09154Help
Entry
AGROH133_09154    CDS       T01432                                 

Gene name
acs
Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00010  Glycolysis / Gluconeogenesis
agr00620  Pyruvate metabolism
agr00640  Propanoate metabolism
agr00680  Methane metabolism
agr01100  Metabolic pathways
agr01110  Biosynthesis of secondary metabolites
agr01120  Microbial metabolism in diverse environments
agr01130  Biosynthesis of antibiotics
agr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGROH133_09154 (acs)
   00620 Pyruvate metabolism
    AGROH133_09154 (acs)
   00640 Propanoate metabolism
    AGROH133_09154 (acs)
  Energy metabolism
   00680 Methane metabolism
    AGROH133_09154 (acs)
Enzymes [BR:agr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AGROH133_09154 (acs)
Lipid biosynthesis proteins [BR:agr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AGROH133_09154 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADY65659
UniProt: F0L472
Position
circular:complement(2724002..2725957)
Genome map
AA seq 651 aa AA seqDB search
MSAKIYPVLKSAKARTLIDNERYQKWYQESVEDPEKFWDKHGRRIDWFKPYTKVKNTSFK
GRVPIKWFEDGLTNVSYNCIDRHLKTHGERTAIIWEGDNPYIDKKITYNQLYDYVCRLAN
VLKKHGVKKGDRVTIYMPMIPEAAYAMLACARIGAIHSVVFGGFSPEALAGRIVDCQSTF
VITCDEGVRGGKPIPLKENTDKAIDIAAKQYVIVNKVLVVRRTGGKTGWAPGRDIWYHQE
IATVKPDCPPVKMRAEDPLFILYTSGSTGKPKGVLHTTGGYLVYTSMTHEYVFDYKDGEV
FWCTADVGWVTGHSYIVYGPLANCATTLMFEGVPNFPDQGRFWEVIDKHKVNIFYTAPTA
LRSLMGAGDQFVTRSSRESLRLLGTVGEPINPEAWEWYYHVVGEDKSPIVDTWWQTETGG
ILISPLPGATDLKPGSATRPFFGVQPQLVDAEGNVLEGPADGNLCIIDSWPGQSRSVYGD
HQRFVDTYFSTYKGKYFTGDGCRRDEDGYYWITGRVDDVLNVSGHRLGTAEVESALVSHH
QVSEAAVVGYPHAIKGQGIYCYVTLMAGQSGDYALREELVKHVRNEIGPVATPDKIQFAP
GLPKTRSGKIMRRILRKIAEDDFGALGDTSTLADPAVVEDLIANRQNRTAS
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaaaatctaccccgtgctcaaatcggcgaaagcccgcacgctcatcgacaat
gagcgttaccagaaatggtatcaggagagcgtcgaggatcccgagaagttctgggacaag
cacggccggcggatcgactggttcaagccctataccaaggtcaagaacacgtccttcaag
ggaagagtgccgatcaagtggttcgaggacggcctgacgaacgtctcctacaactgcatc
gaccggcacctgaagacgcatggcgaacgcacggcgatcatctgggaaggtgacaatccc
tatatcgataagaaaatcacctacaatcagctctatgactatgtctgccgcctggcgaac
gtgctgaagaagcatggtgtcaagaagggcgaccgggtcaccatctatatgccgatgata
cccgaggcggcctatgccatgctcgcctgcgcccgcatcggcgccattcattcggtcgtg
ttcggcggcttctcgccggaagccctggccggccgcatcgtcgattgccagtccaccttc
gtcatcacctgcgatgaaggcgtgcgtggcggcaagccgatcccgctcaaggaaaatacc
gacaaggcgatcgatattgccgccaagcaatatgtcatcgtcaacaaggttctggtcgtg
cgccgcaccggcggcaagaccggctgggcgcccggccgcgacatctggtaccatcaggaa
atcgccacggtgaaaccggattgcccgccggtgaagatgagagcggaagatccgctgttc
atcctctacacgtcaggctccaccggcaagccgaagggcgtgctgcacaccacgggcggc
tatctcgtttatacgtcgatgacgcatgaatacgtcttcgactacaaggacggggaggtc
ttctggtgcaccgccgatgtcggctgggtcaccggccattcctacatcgtctacgggccg
ctggcgaactgtgcgacgacgctgatgttcgaaggcgttcccaacttcccggatcaggga
cggttctgggaagtcatcgacaagcacaaggtcaacatcttctacaccgcaccgacggcg
ctccgatccctgatgggggcgggcgaccagttcgtcacgcgttcgtcgcgcgaaagcctg
cggcttctcggcacggtgggcgagcctatcaatcccgaagcgtgggagtggtattaccat
gtggtcggcgaggacaagagccccatcgtcgatacctggtggcagacggaaacgggcggc
attctcatctcgccgctgccgggtgcgacggacctgaagccgggttcggcgacaaggccg
ttcttcggcgtgcagccgcaactggtcgatgccgaaggcaacgtgctggaggggccggcc
gacggcaatctctgcatcattgatagctggccgggccagtcgcggtccgtttacggggat
caccagcgcttcgtcgacacctacttctcgacctataagggcaagtacttcaccggtgac
ggctgccggcgcgatgaggacggttattactggatcactggccgcgtcgatgacgtgctt
aacgtctccggccaccgcctcggcaccgccgaagtcgagtcggcacttgtttcgcatcat
caggtttcggaagcggcggtcgtgggttacccgcatgccatcaaggggcagggcatttat
tgttatgtcacgttgatggcgggccagagcggcgactatgcgttgcgcgaggagctggta
aagcacgtccgcaacgagatcgggccggttgcgacgccagacaagatccagttcgcgcca
ggcctgccgaagacccgttcgggcaagatcatgcggcgtattctgcgcaagatcgcggag
gatgatttcggcgcgcttggggatacctcgacgcttgccgatcctgcggtggtcgaagat
ctcatcgccaaccggcaaaaccgcacggcgtcctga

DBGET integrated database retrieval system